KEGG   Monosiga brevicollis: MONBRDRAFT_38232Help
Entry
MONBRDRAFT_38232  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
mbr  Monosiga brevicollis
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:mbr03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 650 aa AA seqDB search
MSGPLLTEADAPVLDNSFRNVLVLYGLPDPEASKMAKLEKVIISKVLKDYHIVEHRFLVD
EDGKGRGVAFLEFETVEAANTALVALDGYKLDKKHTFQACLLEDMDRILKTEDEFQAPPE
EALDSKLNELQSWLLNSDCYDQVALRYQNMTSIGWNMRNRVNIACEREGWSELGVQWSPL
GSYLATFHQPGISLWGTEKFERINKFAHMGVKFIDFSPCENYMVTFAPATPINEKDPRSI
IIWNLKTGEQMRGFMPPRKYRSAHGEVEEMWPVFKWSHDDKYFARMTDADTLAVYDTESF
KKLDNRGIQITGLQEFAWSPRDNVIAYWQPEIAQRPARMGILDIPRKEDLTTRNMFSVVA
CHLVWQKSGEHVCVHVVRHNKKKTQLYSDFQIFHMNGKDIPCDQLELHRPVVGFFWAPEG
NRFAVISGQHPMTRVETYSLESRKIVKHPEHLDITCESVFWSPTSQHMILADRFKMNSQL
VFVDANTMETIRIVEHAMVTDIEWDPTGRYVASIASASKTQVDTGYIMWSFQGNQLHKMN
RKHFFQLLWRPRPKELINDDDLKEIRRNWKKYQTNFEAADKMMMDQADEETLQARRAMLE
DWSDWQMSVEKRLSELRARLKKLRPEDQEDIVEIVETVEVPVKVEEVIVE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgtccggccccttgcttaccgaggccgatgcgccggtcttggacaactctttccgcaat
gtcctggtgctgtacggtctgcccgaccccgaagcctccaagatggccaagctcgaaaag
gtcatcatcagcaaggtgctgaaggattatcatatcgtcgagcaccgcttcctcgttgat
gaggatggcaagggtcgtggcgttgcctttcttgagttcgagactgtcgaggccgccaac
accgccctcgtggccctcgacggctacaagctggacaagaagcacaccttccaagcctgc
cttctcgaggatatggaccgcatcctcaagaccgaagacgagtttcaagccccgcccgag
gaagccctcgactcaaagcttaacgagcttcagagctggttgctcaacagcgactgctac
gaccaggtcgcgctgcgttaccagaacatgacctcgatcggctggaacatgcgtaaccgc
gtgaacattgcctgcgagcgtgaaggctggtccgagcttggtgtgcaatggtcgccgctc
ggctcatacctggccacttttcaccaacctggtatctccctctggggtactgagaagttt
gagcgcatcaacaagtttgcgcacatgggtgtcaagtttattgatttttctccttgcgaa
aactacatggtcacctttgccccggctacgcccatcaacgagaaggaccctcgcagcatc
atcatctggaacctcaagacgggtgagcaaatgcgcggtttcatgcccccacgcaagtac
cgcagcgcccacggtgaggtcgaggagatgtggcccgtcttcaagtggagccatgacgac
aagtactttgcccgtatgactgacgcggacacgcttgccgtgtacgacaccgagtcgttc
aagaagctggataaccgtggcattcaaatcacgggtctgcaagagtttgcctggtcgccg
cgcgacaacgttattgcttactggcagcccgagattgcccagcgccccgcccgcatgggt
atcctggatattccccgcaaggaggatctcaccactcgcaacatgttctccgtcgttgct
tgccacctcgtctggcaaaagtctggcgagcatgtttgcgtgcacgtcgtacgccacaac
aaaaagaagactcagctgtattctgatttccagattttccacatgaacggcaaggacatc
ccctgcgatcagcttgagctgcaccgccccgtcgttggatttttctgggcaccagagggc
aaccgctttgccgtcattagcggacaacatcccatgactcgtgttgagacctactcgctc
gagtcgcgcaagattgtcaagcaccccgaacacctcgacatcacctgcgagagcgtgttc
tggagccccacctctcagcacatgatcctggccgatcgcttcaagatgaacagccagctc
gtgtttgtggacgccaacacaatggagacgatccgcatcgttgagcatgccatggtgaca
gacattgaatgggatcccactggccgctacgtggccagtattgccagtgcgtccaagacg
caagtggacacgggctacatcatgtggtctttccagggcaaccaactgcacaagatgaac
aggaaacactttttccagcttctgtggcgtccgcgtcccaaggagctcatcaacgatgat
gacctcaaggagattcgtcgcaactggaagaagtaccagaccaactttgaggccgcggac
aagatgatgatggatcaggcggacgaggaaaccctgcaggctcgtcgtgccatgctcgag
gactggagcgactggcaaatgtctgtcgagaagcgcctgtccgagctgcgtgctcgtctc
aagaagcttcgtcccgaggatcaggaagacattgttgaaattgtggagactgtcgaggtg
cctgtcaaggtcgaggaggttatcgtggagtaa

DBGET integrated database retrieval system