KEGG   Monosiga brevicollis: MONBRDRAFT_38587Help
Entry
MONBRDRAFT_38587  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mbr  Monosiga brevicollis
Brite
Enzymes [BR:mbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MONBRDRAFT_38587
Transfer RNA biogenesis [BR:mbr03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    MONBRDRAFT_38587
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 551 aa AA seqDB search
MFTITLWLAENLGTPQERMFKVVSEVVEELVRAHDNKHDINLNALKQRVASKYKLHSQPR
LVDIIAAVPAQYKKIAVVAVMCKPHRCPHIAMTGNICVYCPGGPDSDFEYSTQSYTGYEP
TSMRAIRARYNPYLQTRHRVEQLKSLGHSVDKVEFIVMGGTFMALDAEYRDYFIRNLHDA
LSGHTSNNVKEAVEYSERSRTKCIGITIETRPDYCLRPHLNSMLEYGCTRLEIGVQSVFE
DVARDTNRGHTVKAVSESFHGAKDTGFKVVAHMMPDLPNMGLERDVAQFVEFFENPAFRA
DGLKLYPTLVIRGTGLYELWKTGRYKSYPPSVLVDLVAQILALVPPWTRVYRVQRDIPMP
LVSSGVEHGNLREHALARMQELGTKCRDVRTREVGIQEIHHRVRPFEVELIRRDYYANGG
WETFLAYEDPEQDILIGLLRLRKCSDQTYRPELKDGCSIVRELHVYGSVVPVQSRDPGKF
QHQGFGTLLMEEAARIAKSEHGSRKLAVISGVGTRDYYRKLGYELEGPYMVKSLEDELVL
DEMIDADLLDA
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgttcaccatcaccttgtggctcgcagagaacctcggcacgccccaggagcgcatgttc
aaggtcgtttccgaggtggttgaggagctcgtgcgtgctcatgacaacaaacatgatatc
aatctcaacgcactcaagcagcgcgttgcttcaaagtacaaacttcattcccaaccgcgc
ttggttgatatcattgccgccgttcccgcgcagtacaaaaagattgccgtggtcgcggtc
atgtgcaagcctcatcgctgcccccacattgccatgaccggcaacatctgcgtctactgc
cccggtggtcctgacagcgactttgaatactcaactcagtcctacaccggctacgagccg
acctcgatgcgtgccattcgcgcccgctacaacccctacctgcagacacgccatcgtgtc
gagcagctcaagtcactcggtcatagcgtcgacaaggttgagtttatcgtgatgggcggt
acctttatggcgctggatgctgagtatcgcgactactttatccgcaatctccacgatgcg
ctttccggccataccagcaacaatgtcaaggaggccgtcgagtactcggaacgtagccgc
accaagtgcattggaatcaccatcgagacacgacccgactactgcctacgcccccacctc
aacagcatgctcgaatacggctgcactcgccttgaaattggcgttcagagtgtattcgaa
gatgttgctcgcgacacaaatcgtggccacacagtcaaggcagttagcgagtccttccat
ggagccaaggatacgggcttcaaggtcgtggcacacatgatgcctgatctgcccaacatg
ggtctcgagcgcgatgttgcacaatttgtcgagttttttgagaaccccgccttccgtgcc
gacggtttgaagctctatcccacccttgttattcgcggcacgggcctgtatgagctttgg
aagacgggtcgctacaaatcctaccctccatctgtcctcgtggacttggtggcccagatt
cttgctcttgtcccgccgtggacgcgcgtgtaccgtgttcagcgagatattcccatgcct
ctggtgtcctctggcgtcgagcacggcaacctgcgcgagcatgctctggcgcgcatgcag
gagctgggcaccaagtgccgtgacgtgcgcacgcgtgaagtgggcatccaggagatccat
caccgcgtgcgtccctttgaggttgaactcatccgtcgtgattactacgccaatggtggt
tgggaaacatttttggcgtacgaggatccagagcaagacattttgattggtttgctgcgc
ttgcgcaaatgctctgaccaaacctatcgtcccgagctcaaggatggatgctcgattgta
cgtgagctgcacgtgtacggctcggttgtgccggtgcaatcgcgagatcccggcaaattc
cagcatcaagggtttggtaccctgttgatggaggaggctgcgcgcatcgccaagagtgaa
catggcagccgcaaattggctgtcatctcgggcgtgggcacccgtgactactatcgcaag
ctcggctatgagctggaaggcccttacatggtcaaatctctggaggacgagctagtcttg
gatgaaatgattgatgccgatcttttggatgcttag

DBGET integrated database retrieval system