KEGG   Monosiga brevicollis: MONBRDRAFT_38883Help
Entry
MONBRDRAFT_38883  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mbr  Monosiga brevicollis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MONBRDRAFT_38883
   00052 Galactose metabolism
    MONBRDRAFT_38883
   00500 Starch and sucrose metabolism
    MONBRDRAFT_38883
   00520 Amino sugar and nucleotide sugar metabolism
    MONBRDRAFT_38883
Enzymes [BR:mbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MONBRDRAFT_38883
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 497 aa AA seqDB search
MALKRSESLNSVTSYSHEQGDAALTLSAELSKLIMTAPLNLRDEVERNCKGFQTLFDQYM
GERGTKISWDKIRPPPAGSIVPHATVAAGEPKAASELSVPLSKLAVLKLNGGLGTSMGCV
GPKSVISVRNDLTFLDLCVRQIEHLNDSYGTTVPLVLMNSFNTHDDTQKVLRKYKKTEVK
VFNQSQYPRILKETLQPLPKNTDNSDEDWYPPGHGDLYRSFYDSGLLQELLDDGKEWVFI
SNIDNLGATVDEDILRYVTRPGNDCEFVMEVTDKTRADVKGGTLIEYEGRIRLLEVAQVP
KDHEEDFKSVTKFRVFNTNNLWINLHAIKRLVEEESLHMEVIENKKTLDDGRVIIQLEQA
VGSAIKNFNGAIGINVPRSRFLPVKKTSDLLLVMSNLYQLRHGTLSMNASRLFDSVPLIK
LGDHFKKVKDFLRRFENIPDILELDHLTVSGDVKFGKNVILRGTVIIIAQENDSIDIPQG
SVLENKIVTGNLRILDH
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgaagcgttcggaatctctcaacagcgtgacctcgtactcgcacgagcaaggc
gatgcagcgctcaccctctcggcggagctctccaagctcatcatgaccgctcccctcaac
ctccgcgacgaggtcgagcgcaactgcaagggcttccaaaccctctttgatcagtacatg
ggcgagcgcggcaccaagatcagctgggacaagatccgcccgccgccggctggctctatt
gtgccacatgcaacagtggctgccggggaacccaaggcggccagtgaactgagcgtgcct
ttgtccaagctggccgttctcaagctcaacggtggtctcggcacctccatgggctgtgtt
ggccccaagagcgtcatctcggtccgcaacgatctcacctttctggacctttgcgttcgc
cagatcgagcatctcaacgacagctacggcaccaccgtgcccttggtgctgatgaactcc
ttcaacacccacgatgatacccaaaaggttcttcgcaagtacaaaaagaccgaggtcaag
gtcttcaaccaaagccagtacccccgtatcctcaaggaaaccctgcagcccctccccaag
aacacggacaacagcgatgaggactggtatcccccaggccacggcgatctgtaccgttca
ttctacgactctggtctgctccaggagctgctggatgacggcaaggaatgggtcttcatc
agcaacattgacaaccttggcgccacagtggatgaggatattctccgctacgttacccgc
cctggcaacgactgcgagtttgtcatggaagtcacagacaagacacgcgctgatgtcaag
ggtggtaccctcattgagtacgagggccgcattcgcctcctcgaggtggcacaggtgccc
aaggatcacgaagaggacttcaagtcggtcaccaagttccgcgtgttcaacaccaacaac
ctctggatcaacctgcacgccatcaagcgcctcgtggaagaggagtccctgcacatggag
gtcattgagaacaaaaagacgctcgatgacggccgtgtcatcattcaactggagcaagcc
gtcggttcggccatcaagaacttcaacggtgccattggcatcaacgtgcctcgcagccgc
tttttgcccgtgaaaaagacctccgacctgctcctcgtcatgagcaatctctaccagctg
cgccacggcaccttgtccatgaacgcttcgcgcctgtttgactcggtgcctctgatcaag
ctgggtgaccacttcaaaaaggtcaaggattttttgcgtcgctttgagaacattcccgac
attctggagctggatcacttgaccgtgagcggtgacgtcaaatttggcaagaatgtgatc
ctgcggggcactgtcattatcattgcgcaggagaacgactcgatcgacattccccagggc
tccgttctcgaaaacaagattgtgactggcaacctccgaatcctcgaccattag

DBGET integrated database retrieval system