KEGG   Monosiga brevicollis: MONBRDRAFT_39353Help
Entry
MONBRDRAFT_39353  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
mbr  Monosiga brevicollis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 414 aa AA seqDB search
MGDDVFRVYHVNRSQWKIPAYFTDLQPVGSGGYGAVCSAFDVRRNATVAIKKLNRAYELP
ILTKRAYREIKVLRFIKHENVIGLLDMFLSQVDVDSQPDIYLVTEYLPVDLYSVMRSQGY
HPVLLTSTLVVVRPLFFSNIVVDASCNLKIIDFGLARPTAPGVDKTGYVTTRYFRAPEVF
TKPGLYDAAMDMWSVGCIMAELIIGRSLFVGSSPIHQVDAICQIVGKPSDEFIATVPSEY
ARTYLQSLEDYPRQNFQEMFAGADPAAIDLLDRLLQFDERRRPTARDALRHPFFAEYHIE
EDEPVVKDGQVYDATYERLDLDVAGWKAEQFPDVPLALMTPSAQQTFVAYQQSLVQQQAA
PAEAGMLASIDAQLAELRQQGQSSLGFSADEEDEFVRSLLGEIEADDGIHDEQF
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgggggacgacgtctttcgggtgtaccatgtcaatcgctctcagtggaagatcccggct
tactttactgatctacagccagtgggcagtggtggctacggtgccgtttgctcggccttt
gacgttcgccgcaatgctactgttgccatcaaaaaactcaatcgtgcctatgagctcccc
attttgaccaagcgcgcctatcgtgagatcaaggttcttcgcttcatcaagcatgagaac
gtgattggccttcttgacatgtttctgagccaagtggatgtcgacagccaacccgacatt
tatctcgtcaccgagtacctgccggtcgacctctactctgtcatgcgttctcagggctac
cacccggtcctgctgacctcaacccttgtggtcgtacgcccattgttcttcagcaatatc
gtcgttgatgcatcctgcaatctgaagattattgactttggcctggcccgtccaactgcc
cctggtgtcgacaaaacgggctatgtcaccacacgctactttcgcgccccagaagtgttt
acaaaaccgggtctctacgacgcggcgatggacatgtggtcggtgggctgtatcatggcg
gagctgatcatcggccgatccctctttgtgggctcatcgcccatccatcaagttgacgcc
atttgccagattgtgggcaagcccagcgacgagtttattgccaccgtcccgtctgaatat
gcacgcacatacttgcagtccttggaggattatccgcgccaaaactttcaagagatgttt
gctggggctgatccggcggccattgatctcttggatcggctgcttcagtttgacgagcgc
cgccgccccacggcgcgtgacgctttgcgtcaccctttttttgccgagtatcacattgaa
gaggatgagcctgtggtcaaggatgggcaggtgtatgatgcgacatatgagcggctcgac
ctggacgtggctggctggaaagcagagcaatttccagatgttcccctggccctgatgaca
ccatccgctcagcagacatttgtcgcttaccaacagtcgcttgttcagcaacaagcagcc
ccggcggaggccggcatgctcgcttccatcgatgcccaactcgccgaactgcgtcaacag
ggccaatcaagcctcggcttttctgcagacgaggaagacgaatttgtacgctccctcctc
ggcgaaattgaagccgacgatggcatccacgacgagcaattttag

DBGET integrated database retrieval system