KEGG   Monosiga brevicollis: MONBRDRAFT_39353Help
Entry
MONBRDRAFT_39353  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mbr  Monosiga brevicollis
Pathway
mbr04933  AGE-RAGE signaling pathway in diabetic complications
Module
mbr_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    MONBRDRAFT_39353
Enzymes [BR:mbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     MONBRDRAFT_39353
Protein kinases [BR:mbr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   MONBRDRAFT_39353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 5896215
NCBI-ProteinID: XP_001750951
JGI: 39353
UniProt: A9VE09
AA seq 414 aa AA seqDB search
MGDDVFRVYHVNRSQWKIPAYFTDLQPVGSGGYGAVCSAFDVRRNATVAIKKLNRAYELP
ILTKRAYREIKVLRFIKHENVIGLLDMFLSQVDVDSQPDIYLVTEYLPVDLYSVMRSQGY
HPVLLTSTLVVVRPLFFSNIVVDASCNLKIIDFGLARPTAPGVDKTGYVTTRYFRAPEVF
TKPGLYDAAMDMWSVGCIMAELIIGRSLFVGSSPIHQVDAICQIVGKPSDEFIATVPSEY
ARTYLQSLEDYPRQNFQEMFAGADPAAIDLLDRLLQFDERRRPTARDALRHPFFAEYHIE
EDEPVVKDGQVYDATYERLDLDVAGWKAEQFPDVPLALMTPSAQQTFVAYQQSLVQQQAA
PAEAGMLASIDAQLAELRQQGQSSLGFSADEEDEFVRSLLGEIEADDGIHDEQF
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgggggacgacgtctttcgggtgtaccatgtcaatcgctctcagtggaagatcccggct
tactttactgatctacagccagtgggcagtggtggctacggtgccgtttgctcggccttt
gacgttcgccgcaatgctactgttgccatcaaaaaactcaatcgtgcctatgagctcccc
attttgaccaagcgcgcctatcgtgagatcaaggttcttcgcttcatcaagcatgagaac
gtgattggccttcttgacatgtttctgagccaagtggatgtcgacagccaacccgacatt
tatctcgtcaccgagtacctgccggtcgacctctactctgtcatgcgttctcagggctac
cacccggtcctgctgacctcaacccttgtggtcgtacgcccattgttcttcagcaatatc
gtcgttgatgcatcctgcaatctgaagattattgactttggcctggcccgtccaactgcc
cctggtgtcgacaaaacgggctatgtcaccacacgctactttcgcgccccagaagtgttt
acaaaaccgggtctctacgacgcggcgatggacatgtggtcggtgggctgtatcatggcg
gagctgatcatcggccgatccctctttgtgggctcatcgcccatccatcaagttgacgcc
atttgccagattgtgggcaagcccagcgacgagtttattgccaccgtcccgtctgaatat
gcacgcacatacttgcagtccttggaggattatccgcgccaaaactttcaagagatgttt
gctggggctgatccggcggccattgatctcttggatcggctgcttcagtttgacgagcgc
cgccgccccacggcgcgtgacgctttgcgtcaccctttttttgccgagtatcacattgaa
gaggatgagcctgtggtcaaggatgggcaggtgtatgatgcgacatatgagcggctcgac
ctggacgtggctggctggaaagcagagcaatttccagatgttcccctggccctgatgaca
ccatccgctcagcagacatttgtcgcttaccaacagtcgcttgttcagcaacaagcagcc
ccggcggaggccggcatgctcgcttccatcgatgcccaactcgccgaactgcgtcaacag
ggccaatcaagcctcggcttttctgcagacgaggaagacgaatttgtacgctccctcctc
ggcgaaattgaagccgacgatggcatccacgacgagcaattttag

DBGET integrated database retrieval system