KEGG   Monosiga brevicollis: MONBRDRAFT_39385Help
Entry
MONBRDRAFT_39385  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mbr  Monosiga brevicollis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MONBRDRAFT_39385
Enzymes [BR:mbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     MONBRDRAFT_39385
Glycosyltransferases [BR:mbr01003]
 Polysaccharide
  Storage polysaccharide
   MONBRDRAFT_39385
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 632 aa AA seqDB search
MSGTSDLLLRAASQLEGDVSTNEVPMTFEVAWEVCNKVGGIHTVIKTKVPQTVAEVGERN
YVCVGPFFPQARTDVEELEPKSEVLAATLDAVRSQGLQLVYGRWLIEGAPQVLLVDIEAS
RHRIDEWKKDLWEQTGIGCPWDDKESNNAIIFGYLVAWFMGEYLHQSEVLRGSHQQCVVA
HFHEWLAGVGLILCRIRKFRLATIFTTHATLLGRYLCADPKCDFYNNLPYFDVDKEAGDR
QIYHRYCIERGSCHSAHIFTTVSKITAYEARHLLKREAEVITPNGLNVVKFSALHEFQNL
HAKSKAKIHQFVKGHFYGHITDEWDLDKTLYFFTAGRYEFVNKGCDLYLESLARLNHMLR
QTGSDVTVVAFVIMPAKTANFNVEALRGQAVVKNLTDTVKTIQGKVGAKMLEQVMRGELP
QSGELLDQTDVLKLKRGLLGAQRDSLPPVITHNLEDDSKDEVLGCIRRFVRHGKRRREPW
GYTPAECTVLGVPSVTSDLSGFGLFLREHVEDPSQYGIYVIDRRFKAPEESIQQLTEHMF
DFCCLNRRQRINLRNRTERLSDLLGWSTLQDYYYMARVKALHRVFPHQYPDPDAKSNTNF
KLRASAANSPKLPRLEPRLEEDQVPMDQLSLE
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcacatcggatctcctccttcgcgctgcctcgcagctggaaggggatgtgtca
accaacgaggtgcccatgacctttgaggtcgcctgggaagtgtgcaacaaagtgggtggc
attcacaccgtcatcaagaccaaggtgccacaaaccgtggccgaggtcggcgaacgcaac
tacgtctgcgtcggcccgttcttcccccaagcccgtacggatgtggaagagctggagccc
aaaagcgaagtgctggctgcgactcttgatgccgtccgctcccaaggcctccagctcgtg
tacggccgctggctgattgagggcgccccacaggtactcctggttgacattgaggcctct
cgccatcgcattgatgaatggaaaaaggatttgtgggaacagaccggtattggatgtccc
tgggatgacaaggaatccaacaatgccatcatctttggctacctcgttgcctggttcatg
ggcgagtacctgcaccaatctgaggttctgcgcggcagccatcagcagtgtgtggtggct
cactttcacgaatggctcgccggcgtcggcctcatcctctgccgcatccgcaaattccgt
cttgccaccatcttcaccacccacgcgaccctgctgggccgatacctgtgcgccgacccc
aagtgcgacttttacaacaacttgccctactttgatgtggacaaggaagcaggggaccgt
caaatttatcaccggtactgcattgagcgtggcagctgccatagcgcacacatcttcacc
accgtgtccaagatcactgcttacgaagcacggcatctgctcaagcgcgaggccgaggtc
atcacccccaacggtttgaacgtggtcaagttttcagctctgcacgagttccagaacctg
cacgccaagagcaaggccaagattcaccagtttgtcaagggtcacttctacggtcacatc
accgatgaatgggatctggataagacgctgtactttttcacggcgggtcgctatgaattt
gtgaacaagggctgtgacctctaccttgagagcctggcccgcctcaatcacatgctgcgc
cagacgggctctgatgtgacagtcgtggcctttgtcatcatgccggcaaagaccgccaat
ttcaacgtagaagcgttgcgtggccaagccgttgtcaagaacttgacggacaccgttaag
accatccagggcaaggtgggggccaagatgttggagcaggtcatgcggggtgagcttccg
cagtcgggcgagctgctggatcaaaccgatgttctcaagctgaaacgtggtctccttggg
gcacagcgcgactcgctgccgccagtcatcacacacaatctggaggatgacagcaaggat
gaggtgcttggctgtatccgccggttcgtgcgccatggcaaacgacgtcgcgagccgtgg
ggctacacgccagccgagtgcaccgtcctgggcgtgccttctgtcacgtcggatttgagt
ggtttcggtcttttcctgcgcgagcacgtcgaggacccttcccagtatggtatctacgtc
attgatcgccgcttcaaggcaccagaggagagtattcagcaattgaccgagcacatgttt
gacttctgctgcctgaatcgccgccagcgcatcaacttgcgcaatcgcaccgagcgtctc
agcgatcttctgggctggtcgacattgcaagattactactatatggcccgcgtcaaggca
ttgcatcgcgtcttccctcatcagtacccggacccggatgccaaatcaaacacaaacttc
aaacttcgagcatccgctgccaactcgcccaagcttccccgtttggagcctcgtctggag
gaagaccaggtgccgatggaccagctcagcctggaataa

DBGET integrated database retrieval system