KEGG   Monosiga brevicollis: MONBRDRAFT_480Help
Entry
MONBRDRAFT_480    CDS       T01042                                 

Definition
hypothetical protein
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
mbr  Monosiga brevicollis
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    MONBRDRAFT_480
Enzymes [BR:mbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     MONBRDRAFT_480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 624 aa AA seqDB search
GAGGIVFKGGGATTRLLVDYVEPARTQILDYLFVPNFGASLQLLKVEIGGDSQSTDGTES
SHMHSPDDLDYQRGYEWWLIQEAKKRNPDIKIYGLPWAFPGWVGEGSGSPFQYPNLTANY
ITKWVDGAKYTYGFDVDYIGVWNERSSDSTYVQTLRKFLDEAGYNNTKIVARDGGADICD
DLAKDPDYNAAVDIIGLHYPSDYSNYSTCYNLSKPIWASEESSSYDDLNGAACWGRIITS
HWALSKMTASIMWNLVGSYLHGTNWYASSMMTAVEPWSGHYEVNPVIWATAHVTQFTKAS
SLLDPATQQPTFHKELTLPPAPQIGWMYLEDGSGSGQLPQGGFYVTLVDPESNDFTINVV
KIDEDHAPCTRPSLPSFNVSEETVTFQLAANMNAPETLAVWYSNFENYTDDAPIFERQAD
VAVGSDGTFQLHVPIGAMYTISTIKNGPQKGSHGTPPASQPAMPLPIKDSFNAYPESQEA
RWWSDQIGAFEVHPATDTKHTSSIMRQMVPELPIGWSDHGSNGPSWANGIAFCIYTSGNY
TLSIGGPQQATGYPDNVVASGTVPGGVSAETWYTIALETVDTKASAWVNNNSVFSGVTVR
NIDTGFAGFGSNLWKAVEFDDVLV
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
ggggcggggggcattgtcttcaaaggaggcggggcgacgactcgactcctggtcgactac
gtcgagccggcccgcacccaaatccttgattacctctttgtccccaactttggcgcctcc
ctacagctcctcaaggtggaaattggtggtgattcgcagtctacggacggtaccgagtcc
agccacatgcactcgcctgatgatctcgactatcagcgcggctacgaatggtggctcatc
caggaagccaagaaacgcaaccccgacatcaagatctatggcctgccttgggcttttcct
ggctgggttggcgagggctccggctcaccctttcaataccccaatctgactgccaactac
attaccaagtgggttgatggtgccaagtacacgtacggctttgatgtcgactacattggt
gtctggaacgagcgcagctcagactccacctacgttcaaaccctgcgcaaatttctcgac
gaggccggctacaacaacaccaagattgtcgctcgcgacggtggcgctgacatttgtgat
gacctcgccaaggatcctgactacaacgcggccgtcgacattatcggtctccattacccc
tctgattactcaaactactccacctgctacaacctgagcaagcccatctgggcctcggag
gagtccagctcctatgacgatctgaacggcgctgcttgctggggtcgtatcatcacctct
cactgggccctgtccaagatgaccgcgagcatcatgtggaatctcgttggctcctacctg
cacggtaccaactggtatgcctcctcgatgatgacggccgtggagccctggtcgggtcac
tatgaagtcaaccccgtcatctgggccaccgcccatgtaacgcagttcaccaaggcaagc
tcgctcttggacccagcaacccagcaacccacttttcacaaggaactgacgcttcctcct
gccccacagattggctggatgtaccttgaagatggctctggctcgggccagctgcctcaa
ggtggcttttatgttaccctggtggacccagagagcaacgatttcacgattaacgttgtc
aagattgatgaggaccacgctccttgcactcgcccctccctgccctcgttcaacgtgtcc
gaggagacagtcacgtttcagctggccgccaacatgaacgcccctgaaaccctcgccgtg
tggtactccaactttgaaaactacacagatgatgctccgatttttgagcgccaggccgac
gtggcggtaggatcggatggcaccttccagctgcatgtgcccattggagccatgtacacc
atctcaaccatcaagaacggcccgcaaaagggctcccatggcacaccaccggcctcgcag
cccgccatgcccctccccatcaaggactctttcaatgcttaccccgagtcccaggaggca
cgttggtggtcagatcaaatcggcgcctttgaagtgcacccggcaaccgacaccaagcac
acctcctccatcatgcgccaaatggtgccggagctccccattggctggtcggatcatggc
agcaatggcccctcctgggccaacggcattgccttttgcatctacacctctggcaactac
actctctccattggtgggccccaacaagctacgggctatccggacaacgtcgttgcgtca
ggcaccgtgcccggtggtgtcagtgccgagacctggtacaccattgccctggaaaccgtc
gacaccaaggccagtgcctgggtcaacaacaactcggtgttctccggtgtcaccgtccga
aacatcgataccggatttgccgggtttggctccaatctttggaaggcagttgagtttgat
gacgttctcgtg

DBGET integrated database retrieval system