KEGG   Monosiga brevicollis: MONBRDRAFT_5087Help
Entry
MONBRDRAFT_5087   CDS       T01042                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
mbr  Monosiga brevicollis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1941 aa AA seqDB search
MPVLSDLVYEAGLSEELVHGLTLIAEGLPSLAGQLKRRTLDLLCTVLQGTPYHHPGHPDS
RTLLASTPSRTTTRRNSVNKGSKASTVLAAGAHTPNRRASKAQLIVLALRTLRTYDLSGF
VLTKLARDTIATYLSDDNDTVREEACLTCAALVVPPTQMPLANAYRLEPRAVTEVLSQLL
CNAISEGRSTIRKHILEALTPQSYPYLCKAETLQLLFVCLHDRDHQTQLTAMSLVGNLCE
YNPAYVVPALRRQLENYLQTFKLVDTAAAEEANSRLLQELIRSAPRVVVPYVDAIMKALL
PRISHANEEIQIAALGAVGELAVFSGLQLEEHLAVIMPVLLDCLRDHLSMNRRLSALVVL
GKVARGTGYVTLPYEDYPALMKTLYACYVEGQSTQIRLEAGRALGVIGALDPHREKSATG
EAEAEAKSNQAKLDAQQVSSTVSQHATANAPDELQFTIGSEEYYMDLAVRELYMIAYSPA
MDTNMHENLVHSLGTIVVKSGIKLVPYLPMIVPAFLHMVEHCNPARRHMLFKEISKIVDI
FGPHVRPYMNDIIQCVTRYWYPLSDTHARNMSHAFKKYVPELLEHVMAIIASDQTDTRRP
TVHALEAISLLGTLVEDRIYSVIRGLVNVIAAYVGVPVHVRQEALNTLELLMYEIPIGDQ
ASGVFNALMRVVRYEPRLRPPAVAALQPLPMEPGSARGVNRAKPELILKLAKQADDSLNF
DWPTWIRRFSVSLLKESKSPSLAACQYLALRFEPFARKVFNAAFVSCWKELTPEEQAEMT
DGLERAMKADHIFMQMMLNVAEFMSHYFERVGLPFSNQLLGRMALECNAYAKALRYKESE
LGSHFDMRWLYSGIVLRPVQATEEILGAVEDLIEITQALQQPEAAQGALTFVRMQTTLSA
DTDIQPSWYEKLGEWDKALLSYSQLQDPEHPSFDIDLRILVCLDNLGKWTILYDNLVHLW
AQSDVAQKQALAPLGCSASCGLNRWESIATFLSFMDEQDPMTPFYGAVLAIHNEVYKVAQ
DLIDKSRDLLQPTLATLWGESYARGYNHVVTLQRLAEMEEVVQYKQLDRDPIAQDRIRGM
WLTRLNGCQYNPSVWQRILEVRALVLTPEEDCLMWLKYASLCRKSSTLGSAEHFSRIGLD
RCDANADPESQLPHHNPPIAYAYIKHVWHTGAHETAIQYLYVLIDELSARKEEDEQQPED
VRLLARCYHKLGLWQAAPHLSSAGTVNTDLTDELIESIIESFRYATLFDRVWYKAWHSWA
YMNYEAVKHYGQRRNPRAYLQHAIMSIKGFFNSIALSDESSLQDTLRLLTLLFSYGHHSD
VVQTFATGLSTVNIDTWLQVLPQLIARIQIKDGKIRGLLHELLLQVGRKHPQALLFPLTV
AAHNHREASARRDAAQVLLSRMRQHSSELVEQALIVSEELIRVANLWSEKWFEGIEEASK
LYADRQLDAMYATLLPLHEQLNGIGQDATIAEQAFLKLYGAELRDAWEWMRKYQRTEDKQ
DITTAWDHYFHVYRTITKALHNLTSLELKEVSPKLLEAGDLQLVVPGAYDHTSQEQVYID
SFAPQLRVINSKQRPRRLTIKGSNGRTYEYLLKANEDLRQDERVMQLFGLVNVLLNGSSL
TMHKHLHIFTYYILPLSPKLGLIEWVPTCDTLHSLIKEYRERSGVALNAEVRFMLQLVSN
MEQLTLIQKVEVFRHALSRTTGDDLARVMWLRSGNSEQWLERRGNFTRSLAVMSMVGYIL
GLGDRHPSNLMIDRRTGGVMHVDFGDCFEVATQRSKFPEKVPFRLTRMLIAAMEITGVHG
TFRITCENTMSVLRDNADSVMAVLEAFIHDPLIDWLFARGRNGESWSCFATCRWVPRGID
CLMRGMHRLLSPGPLPLQNHTDEVVNRRALRVIARVRDKLTGADFSTEEILDIPSQVARL
IRDATLHENLCQHYTGWCPFW
NT seq 5826 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtgctctcagacctggtatacgaggctggtctctctgaagagttggtacacggc
ctcacactgatagcagaaggcctgccctcactggccggtcagctcaagcgccgcacgctg
gatcttttgtgcaccgtcctccagggcacgccctatcaccacccaggacaccccgattca
cgcacgctgctggcctccaccccgagtcgcacgaccacgcgccgcaactcggtgaacaaa
ggcagcaaggcctcgaccgtcttggctgctggggcacacacgcctaaccgccgcgcctcc
aaggctcaacttatcgttctggccctccgtacgctgcgtacatatgacctcagtggattc
gtgctcaccaagctggcccgtgataccatcgctacctacctgtctgacgataatgacacg
gttcgcgaggaagcttgtctgacttgcgccgccctggtcgtacctccgactcagatgccg
ctggccaatgcctatcgcctcgaacctcgcgctgtcacggaggtactctcgcagttattg
tgcaacgccatctctgagggccgctccaccattcgcaagcacattttggaggccctcacg
ccacagtcctacccctatctctgcaaagccgagaccctgcaactccttttcgtctgtctt
catgaccgggaccatcagacgcagctcacagccatgagcctggttggaaacctatgcgag
tataaccctgcatacgtggtgcccgccctccgtcgccagttggagaactatttacagaca
ttcaagctggtggacacggcggctgcagaagaagccaactctcgtttgctgcaggagctc
atccgctctgcacctcgcgtcgtcgtcccttacgttgacgccatcatgaaggccctcttg
ccgcgtatctcacacgcaaacgaggaaattcagattgctgccctcggtgccgtgggcgaa
ctcgccgtgttcagtggcctacagctcgaggagcacctcgccgttatcatgcccgtcttg
cttgattgtttgcgggaccacctctccatgaaccgccgactctcagcgctggtcgttttg
ggcaaggtggctcgcggcacgggctatgtgaccctgccctacgaggattatccggctctc
atgaagacgttgtatgcctgctacgtcgagggccagagcactcagattcgcctcgaggcc
ggccgcgcccttggcgtcattggtgcactggaccctcatcgtgaaaagtcggccactggc
gaagcggaagcggaggccaaatccaatcaggccaagttggatgcgcagcaggtctcttcg
accgttagtcagcacgccactgccaatgcgcctgatgagcttcagttcaccattggcagc
gaggagtactacatggaccttgcagtccgcgagttgtacatgattgcctactctccggcc
atggacacgaacatgcacgaaaaccttgttcactcgctgggcaccattgtcgtcaagtcg
ggcatcaagcttgtgccctatcttccaatgattgtccccgcctttttgcacatggtggaa
cactgcaacccagcacgccggcacatgctcttcaaggagatttccaagattgttgacatc
tttggacctcatgtgcgaccatacatgaacgacattattcagtgtgtcacgcgctactgg
taccctctatctgatacccacgcccgcaacatgagccacgccttcaaaaagtacgtgcca
gagctgctggagcacgtcatggccatcattgcctcggatcagacggacacgcgccgtcca
accgtacacgccttggaggccatctctcttttgggcacacttgtcgaggatcgcatctac
tcggtcattcggggccttgtcaacgtcatcgctgcctacgttggcgtaccggtgcacgtg
cggcaggaggccctcaacacactcgaactcctcatgtacgagattccaatcggcgaccag
gcttcgggcgtcttcaacgctctcatgcgcgttgtacgctacgagccgcgtctgcggcct
cccgcagttgctgccttgcagcccctgcccatggaacccggcagcgctcgcggtgtgaat
cgcgccaaacccgagctcattctcaagctagccaagcaggctgacgacagcctcaacttt
gactggcccacgtggattcgccgcttctccgttagcctgctgaaagagtccaaatcgcct
tcgctggctgcctgccagtacctcgccctgcgctttgagccctttgcacgcaaggttttc
aacgccgcctttgtctcctgttggaaggagctgacacccgaggagcaggccgagatgacg
gacggcctggagcgcgccatgaaggctgaccacattttcatgcaaatgatgctcaatgtg
gcggagtttatgtctcactattttgaacgcgtgggtctgcccttctccaaccaattgctt
gggcgcatggcgctcgagtgcaacgcttatgcaaaggccctccggtacaaggagagcgag
ctcggcagccattttgatatgcgatggctatacagcggcattgttttgcgccccgtccaa
gcaacggaagaaattctgggggcagttgaggatctcattgagatcacgcaggctttgcag
cagcctgaagcagcgcagggcgcgctcacctttgtgcgaatgcaaacgaccttgtctgcg
gacacggacattcaacccagctggtacgaaaaactcggcgaatgggacaaggccttactg
tcctacagccagctccaagacccagaacacccgtccttcgatattgatctgcgcattctc
gtgtgtctggacaacctgggcaagtggaccattctatatgacaacctggtgcacctgtgg
gcacagagtgatgtggcccaaaagcaggcgctggcgcctctgggctgctcggcctcgtgc
gggcttaatcgttgggagtccatcgccacgttcctgtccttcatggacgagcaggatccc
atgacacccttctacggcgccgtgctggccattcacaacgaggtgtacaaggtcgcgcag
gacctgattgacaagtctcgggacctgcttcagcctacactcgcaacactgtggggtgag
tcgtacgcccgcggctacaatcatgtcgtgacgttacagcgcttggctgagatggaggag
gtcgtgcagtacaaacagttggaccgagaccccatcgcccaagaccgaatccgtggcatg
tggttgactcgtctcaatggctgccagtacaatccgtcggtgtggcaacgaatcttggag
gttcgcgcgttggtgcttacccccgaggaagactgcctcatgtggctcaagtatgccagt
ctttgtcgcaagtcttcaacgctgggctcggccgagcactttagccgcatcggcctcgac
cgctgcgacgccaacgcagaccccgagtcgcaactccctcaccataatccacccattgcg
tatgcttacattaagcacgtgtggcacactggtgcgcatgaaaccgccatccagtatctc
tatgtcctcattgacgagctcagcgcgcgcaaggaagaggacgaacagcagcccgaagat
gtgcgactgctggcccgctgctaccacaagctcggcctctggcaggctgcgccacacctt
tcgtcagcaggcaccgtcaacacggatctgacagacgagctgattgagtcgattatcgag
tccttccgctacgctaccctctttgatcgcgtctggtacaaggcctggcactcgtgggcc
tacatgaactacgaggcagtgaagcactacggccaacgccgtaaccctcgcgcctacctg
cagcacgccattatgagcatcaagggcttttttaacagcatcgccctttcggatgagagc
agccttcaagatactctgcgcctcctcacgcttctcttcagctacggccaccacagtgac
gtggttcagacgttcgctacgggcctcagcacggtcaacattgacacttggctgcaggtt
ttgccgcagctcattgcgcgtatccagattaaggatggaaagattcgtggccttttgcac
gagctgctgcttcaggttggccgcaagcatccacaagcactgcttttcccgctgacggtg
gcagcccacaaccatcgcgaggcgagcgcgcggcgggatgccgcacaggtgctgctgagt
cgcatgcggcaacactcgagcgagttggttgaacaggctctgatcgtcagcgaggaactc
atccgcgtggccaatctgtggtcggagaagtggtttgagggcatcgaagaggcttccaag
ctctatgcagatcgtcagctggacgccatgtacgccacgctgctgccgctgcatgagcag
ctcaacggcattggccaggatgctacgattgccgagcaggcgtttttgaaactgtacggt
gccgaattgcgcgacgcgtgggaatggatgcgaaagtatcaacggacggaagacaaacaa
gacattaccaccgcgtgggaccactactttcacgtgtaccgtaccatcaccaaggcactg
cacaacctcacctcgctcgagctgaaggaggtgtcacccaagctccttgaagcaggagat
ttacagctcgtagtccccggtgcctacgatcacacctctcaagagcaggtttacattgac
tcctttgcaccgcaactgcgcgtgatcaactccaagcagcgtccgcgacgcctgacgatc
aagggtagcaacgggcgcacgtatgagtacttgctgaaggccaatgaagatctgcgacag
gatgaacgcgtcatgcagctgtttgggctggtcaacgtgctcctgaacggtagctctctg
accatgcataagcatcttcacatttttacctactacatcctgcccctgtcgcccaagctg
ggtctcattgaatgggtaccaacatgcgacacgctgcactccttgattaaggagtaccgc
gagcgcagcggtgtagcgctcaatgcggaagtgcgcttcatgctccagcttgtgtccaac
atggagcagctaaccctcattcagaaggttgaggttttccgacacgccctgtctcgtaca
acgggggatgatctcgcacgcgtcatgtggctgcgcagcggcaactcggagcaatggctt
gaacgccgtggcaactttacgcggtctttggccgtcatgtcgatggtgggctacattttg
ggtctaggcgatcgccacccctctaacctcatgattgatcgccgcacgggtggcgtgatg
catgtcgactttggcgactgctttgaggtggccacgcaaagatccaagtttccggaaaag
gtgcccttccgtctcacacggatgctgattgccgccatggagattacgggcgtgcatgga
acattccgcatcacttgcgagaacaccatgtcggtgctgcgcgacaatgcggacagtgtc
atggccgtgctggaggcattcattcacgaccctttgattgactggctctttgcacgagga
cgtaacggtgagtcttggtcttgttttgccacttgtcgctgggtcccacggggaattgac
tgcttgatgcgtggcatgcaccgactgctctcacctggcccgttgcccttgcagaaccac
acggatgaggtggtcaaccgtcgtgcattgcgcgtcattgcccgcgtgcgcgacaagcta
acgggtgctgacttttctacggaggagattttggacattccatctcaggtggctcgcttg
attcgcgatgctaccttgcatgaaaatctctgtcagcactacacgggctggtgtccgttc
tggtaa

DBGET integrated database retrieval system