KEGG   Monosiga brevicollis: MONBRDRAFT_5539Help
Entry
MONBRDRAFT_5539   CDS       T01042                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
mbr  Monosiga brevicollis
Brite
Exosome [BR:mbr04147]
 Exosomal proteins
  Proteins found in most exosomes
   MONBRDRAFT_5539
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 239 aa AA seqDB search
MEQPLQELVDQLVAATPHVHSAAIIRRRDAKINCHSQAFTPTNDLKHLLEAFRDTRYVRE
NNLVYDGRNWLCLRADHDAVYARDGRRGLIAYATANHIVVGLYEADMTPAVCVETIELLE
ASTLASKGCKRLLKSAPNFAPAYPKHNKAQQSAPISIFQSNAHQTHELTHLGLGLREQVL
QLRLWRFKRENHCETKSKSQTAPHPIWVKSLHRPKSSCGNLPRQSSRRLLCPQQQLAQR
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggagcagccgctgcaggagctggtcgatcagctggtggccgcgacccctcatgttcac
tccgctgccatcattcgccgccgcgacgccaagatcaattgccactcgcaggcatttacg
cccacaaatgacctcaagcacttgctcgaggcctttcgcgatacgcgctacgtgcgcgag
aacaatcttgtatatgatggccgcaactggctttgcctgagagccgatcacgatgccgtc
tacgcccgagacggtcgccgcggtctgattgcctacgcaactgccaaccacattgttgtc
ggtctctacgaagcagacatgacacccgccgtctgcgttgaaaccatcgagcttcttgag
gcatcgaccttggccagcaagggctgcaaacgtttgctcaagtccgcacccaatttcgct
cccgcctaccccaagcacaataaagcacagcagtcagccccgatcagcatcttccaaagc
aatgcacaccaaacccacgagttaacccaccttggcttgggcctccgtgagcaggttctc
cagctcagactgtggcgtttcaagagggaaaaccactgtgagaccaaaagcaagtcgcag
acagccccacatccaatctgggtcaagagcctacatcgacctaaaagctcgtgcggaaac
ctaccgcgacagtcttctcgtcgcttgctgtgccctcagcagcagctggcgcagcgctga

DBGET integrated database retrieval system