KEGG   Monosiga brevicollis: MONBRDRAFT_5881Help
Entry
MONBRDRAFT_5881   CDS       T01042                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
mbr  Monosiga brevicollis
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mbr00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mbr00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:mbr03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mbr03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:mbr03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:mbr03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mbr03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 118 aa AA seqDB search
MSLYQHFEARPKVAERDIPKYKQKRTSSSSSIKVQDVPAAPATVVAGRESPATLAGHHQY
LRQFDLDMTFGPCVGVSRRERWERADAFGLNPPKAVLRLLENHPQDETFQQCLWYNTL
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgtatcagcactttgaagctcgccccaaggttgcggagcgagacattcccaaa
tacaagcagaagcgcacttcttccagctcctccatcaaagttcaagacgttcccgccgca
cccgccacggtagtcgccgggcgcgagtcccccgccacccttgccggtcaccaccagtac
ttgcgccaatttgacctcgacatgacctttggcccttgcgttggcgtgtcacgacgagag
cgctgggaacgggctgacgcctttggcttgaatcctcccaaagccgtcctgcggctcctg
gaaaaccatcctcaagatgaaacctttcaacagtgtctctggtacaacactctctga

DBGET integrated database retrieval system