KEGG   Monosiga brevicollis: MONBRDRAFT_7901Help
Entry
MONBRDRAFT_7901   CDS       T01042                                 

Definition
hypothetical protein
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
mbr  Monosiga brevicollis
Brite
Enzymes [BR:mbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MONBRDRAFT_7901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 269 aa AA seqDB search
MGNNRIAPWYFSPYPECFTTVDIMYICETCLKFSRSETTYRRHKAKCKLRHPPGTEIYRK
DGIQFFELDGRKQRDYCQNLCLLSKLFLDHKTLQYDTDPFLFYVMCSLDERGSHIVGYFS
KEKESEQEYNVACILTLPQYQRMGYGTILIEFSYALSQEEHKTGSPEKPLSDLGLLSYRK
YWSQAIVEVLRDVKEDISINDIADRTSIKVEDIISTLQHLSMIKYYKVNLQGYLDRRLSL
EHDKAMKKRRIRIDPKFLKWTPTDWTSGW
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacaaccgcattgccccgtggtacttttccccctacccagagtgctttactacc
gtcgatattatgtacatttgtgaaacttgtctcaagttcagtcgcagcgagaccacgtat
cgacgtcacaaggcaaagtgcaaactgcgtcacccgcctggtactgaaatctaccgtaag
gacgggattcaattctttgagctcgatggccgcaaacaacgcgactactgtcagaacctc
tgcctcctatccaagctctttcttgatcataagacgctgcaatacgacacagaccccttt
ctgttctacgtcatgtgcagtctggatgagcggggcagtcacatcgtggggtacttctcc
aaggagaaggaatcagaacaagaatacaacgtcgcctgcatcctgaccctgccccaatat
cagcgcatgggctacggcaccatcctcattgaatttagttatgcgctgtcacaggaggag
cacaagactggttcgcctgagaagccactctctgatctaggtcttttgagttaccgcaaa
tactggtctcaggccatcgtcgaagtgctgcgagatgtcaaggaggacatttccattaat
gacattgctgatcgcaccagcatcaaagtggaggacattatttccacgctccagcatttg
agcatgatcaagtactacaaggtaaacctccaaggctacttggacagacgtctctcgttg
gagcatgacaaggccatgaaaaagcgtcgcattcgcatcgatcccaagttcttaaagtgg
accccgactgactggacttcgggctggtag

DBGET integrated database retrieval system