KEGG   Monosiga brevicollis: MONBRDRAFT_8499Help
Entry
MONBRDRAFT_8499   CDS       T01042                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
mbr  Monosiga brevicollis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MONBRDRAFT_8499
   00052 Galactose metabolism
    MONBRDRAFT_8499
Enzymes [BR:mbr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     MONBRDRAFT_8499
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 410 aa AA seqDB search
MAQVEKAEYGKLSETGETVHIYTLTGAQGLVVKIMDYGATIVSLLAPDESGAKADVVLGF
ATLADWETKNVPYFGAVIGRVANRIAKGEMEVDGKTYTLAINNGPNHLHGGLRGFDKQVW
QSEIVENGVRFSLISPDGQENYPGECKVQVTYTVSEDNKLTLSYEFEVDKRCPVNITNHA
YFNLAGAASGSVRDHKLTMPSTHVTEAIELIPTGKLLPVEIERGYDVNFVVQREDDSGLC
LAAEYVSAAMSPFTSMPVFCFVWAFRLRLRDNPHMECGRGIAWLIPNRDVACGASRLPYN
PYQAFCLETQHFPDSVHRPEFPTVLREAGRKYTSQTVYEFYATSSDATSAKKAKTRTSLS
QERRTLCLLFSGHQGVPCQLSYLQRKPVTGVYLKPTDDERTGQCMSAKAG
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggtggaaaaagccgagtatggcaagctgtcagagacgggtgaaaccgtccac
atctatactctgacgggagcacaaggccttgtggtcaagatcatggactatggcgccacg
atcgtttctctgctagcgcccgatgaatccggggccaaggccgatgtagttcttggtttt
gccactctggctgactgggagacgaagaatgtcccttattttggggccgtgatcggccgc
gtggccaaccgcattgcaaagggagagatggaagtggatggcaagacgtataccttggct
atcaacaacgggcccaaccacctccatggtggtctgcgtggctttgataagcaagtgtgg
cagagtgagatcgtggagaatggcgtacgcttcagcttgatctctccagacggccaggaa
aactatcctggtgagtgcaaagtgcaggtgacttacactgtgtctgaggacaacaagttg
accctgagctacgagtttgaggtcgacaagcgttgcccagtcaacattaccaatcacgcc
tacttcaaccttgcgggggctgcatccggcagcgtgcgcgaccacaagctgacaatgccc
tccacacacgtgaccgaggccattgagctcatccccactggcaagctgttgccggttgag
attgagcggggctacgatgtcaactttgttgtgcagcgtgaggatgacagcggtttgtgc
ctggcagccgagtacgtatcagcagccatgtccccgttcacgtccatgccagtcttttgc
tttgtgtgggcgttccgcctacgcctgcgtgacaaccctcacatggaatgtggacgcggt
atagcgtggttgatcccaaatcgggacgtggcttgcggtgcttcacgactgccctacaac
ccgtatcaagcgttttgtttggagacacagcactttccggacagtgtgcatcgcccagag
ttccccacggtgctgcgcgaagccggtcgcaagtacacctcgcagaccgtctatgagttt
tatgccacaagtagcgacgccacttcggccaaaaaggccaaaacaagaacaagcctgagc
caggaaaggcgaacgttatgcttgcttttctccgggcatcaaggtgtcccatgccaattg
tcatatctgcagaggaagcccgtgacaggcgtgtacctcaagcccacagatgacgagcgg
actggccagtgcatgtcagccaaagctggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system