KEGG   Monosiga brevicollis: MONBRDRAFT_8499Help
Entry
MONBRDRAFT_8499   CDS       T01042                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
mbr  Monosiga brevicollis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mbr00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mbr00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 410 aa AA seqDB search
MAQVEKAEYGKLSETGETVHIYTLTGAQGLVVKIMDYGATIVSLLAPDESGAKADVVLGF
ATLADWETKNVPYFGAVIGRVANRIAKGEMEVDGKTYTLAINNGPNHLHGGLRGFDKQVW
QSEIVENGVRFSLISPDGQENYPGECKVQVTYTVSEDNKLTLSYEFEVDKRCPVNITNHA
YFNLAGAASGSVRDHKLTMPSTHVTEAIELIPTGKLLPVEIERGYDVNFVVQREDDSGLC
LAAEYVSAAMSPFTSMPVFCFVWAFRLRLRDNPHMECGRGIAWLIPNRDVACGASRLPYN
PYQAFCLETQHFPDSVHRPEFPTVLREAGRKYTSQTVYEFYATSSDATSAKKAKTRTSLS
QERRTLCLLFSGHQGVPCQLSYLQRKPVTGVYLKPTDDERTGQCMSAKAG
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggtggaaaaagccgagtatggcaagctgtcagagacgggtgaaaccgtccac
atctatactctgacgggagcacaaggccttgtggtcaagatcatggactatggcgccacg
atcgtttctctgctagcgcccgatgaatccggggccaaggccgatgtagttcttggtttt
gccactctggctgactgggagacgaagaatgtcccttattttggggccgtgatcggccgc
gtggccaaccgcattgcaaagggagagatggaagtggatggcaagacgtataccttggct
atcaacaacgggcccaaccacctccatggtggtctgcgtggctttgataagcaagtgtgg
cagagtgagatcgtggagaatggcgtacgcttcagcttgatctctccagacggccaggaa
aactatcctggtgagtgcaaagtgcaggtgacttacactgtgtctgaggacaacaagttg
accctgagctacgagtttgaggtcgacaagcgttgcccagtcaacattaccaatcacgcc
tacttcaaccttgcgggggctgcatccggcagcgtgcgcgaccacaagctgacaatgccc
tccacacacgtgaccgaggccattgagctcatccccactggcaagctgttgccggttgag
attgagcggggctacgatgtcaactttgttgtgcagcgtgaggatgacagcggtttgtgc
ctggcagccgagtacgtatcagcagccatgtccccgttcacgtccatgccagtcttttgc
tttgtgtgggcgttccgcctacgcctgcgtgacaaccctcacatggaatgtggacgcggt
atagcgtggttgatcccaaatcgggacgtggcttgcggtgcttcacgactgccctacaac
ccgtatcaagcgttttgtttggagacacagcactttccggacagtgtgcatcgcccagag
ttccccacggtgctgcgcgaagccggtcgcaagtacacctcgcagaccgtctatgagttt
tatgccacaagtagcgacgccacttcggccaaaaaggccaaaacaagaacaagcctgagc
caggaaaggcgaacgttatgcttgcttttctccgggcatcaaggtgtcccatgccaattg
tcatatctgcagaggaagcccgtgacaggcgtgtacctcaagcccacagatgacgagcgg
actggccagtgcatgtcagccaaagctggctga

DBGET integrated database retrieval system