KEGG   Monosiga brevicollis: MONBRDRAFT_903Help
Entry
MONBRDRAFT_903    CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K13501  anthranilate synthase / indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.3.27 4.1.1.48 5.3.1.24]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mbr01100  Metabolic pathways
mbr01110  Biosynthesis of secondary metabolites
mbr01130  Biosynthesis of antibiotics
mbr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MONBRDRAFT_903
Enzymes [BR:mbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MONBRDRAFT_903
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     MONBRDRAFT_903
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     MONBRDRAFT_903
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IGPS PRAI QRPTase_C ZnuA
Motif
Other DBs
NCBI-GeneID: 5887758
NCBI-ProteinID: XP_001742294
JGI: 903
UniProt: A9UQ46
AA seq 499 aa AA seqDB search
GNILDVISAQRRRDVEEASRQTPTAQLEAQLSSAPAVLDFAGNIATDVDVPRQAHAYASA
GAATISVLTEPTWFKGTLKDMRAAREAVEGMSDRPAILRKDFLVDRYQVLEARVYGADTC
LLIVAILDDATLGDLLEYARSLDMEPLVEVATPTELQRALAVGAKIIGINNRNLKDFTVN
NDTTRAIMETMGGARPEGLLFCALSGIKTRADAQAYQSVGCDAVLVGESLMRAASPGALI
QSLRGMATTDPLVKICGLRDVETTDATLRLGADMVGLVFAPKSKRLVDVATARSIAQRVT
KSRHSAHVAALRQQILAAQSEENGIAAWQARAQLLREMTAHRPLVVGVFANQPPAEVKRI
ADEVGLDVIQLSGTEGLDAAKDYAGYLVWKAVHVGAGDTGESLLSAAEAIPSASRAHALL
LDTKSPLALGGTGGSFDWDIAANLAKLGMPFFLAGGLDPANVAQAVTKVQPMGLDVSSGV
EADGVKSLDKIGAFVRAAK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
ggcaacattctcgacgtcattagcgctcagcgtcgacgggacgttgaagaggcgagccga
cagacgcccacagcgcagcttgaagcacaactgtcctcggccccagccgttctcgacttt
gctggtaacattgccaccgacgtggatgtgccacgtcaagcccatgcctatgctagcgca
ggcgcagctaccatctctgtcctcaccgagccgacttggttcaagggtacgctcaaagac
atgcgggctgctcgtgaagctgtggaaggaatgagtgaccgcccagcgatcctgcgcaaa
gactttctcgttgatcgatatcaggtgctagaggcgcgtgtctatggcgctgacacgtgt
ttgctgattgtggccattttggatgatgcgacgctcggtgacctcttggaatatgcgcgc
tccctcgacatggagccactcgtggaggtggccacgcctaccgaactgcagcgggcacta
gccgttggagccaagatcattggcatcaataaccgcaacctcaaggattttaccgtaaac
aacgacacgacgcgggcaatcatggagacaatgggcggggcgcggcccgaagggctttta
ttttgtgctctcagcggcatcaaaacccgtgccgatgcccaggcttaccaaagcgtgggg
tgtgatgccgtgttagttggtgaatcactcatgcgtgccgcctctccgggagccctcatc
cagtcattgcgtggcatggctaccacggatcccctggtgaagatttgtggtttgcgggat
gtggaaaccactgatgccactcttcggctgggcgccgacatggtgggcttggtgtttgca
ccgaagagcaagcggctagttgacgtggccacggcccggagcattgctcagcgcgttaca
aaatcccgccacagcgcacacgtggctgcgctgcgccagcaaatactggcagcgcagagc
gaagaaaacgggatcgctgcctggcaagctcgtgcgcagctcttgcgcgagatgacggct
catcggcccctggtggtcggtgtatttgccaaccagcctccggcggaggtgaagcgtatc
gccgatgaggttggactggacgtgatccaactatccggcacggagggcctggatgcggcc
aaagattatgcgggctatcttgtgtggaaggctgtgcatgtgggagcaggcgacacgggc
gagtctttgctttcggcagcagaggcgataccatctgcttctcgagcccatgcgttacta
ctcgacactaaatctccgctggcgcttggcggaaccggtgggtcgtttgattgggacatt
gcagccaacctggccaaattgggcatgcccttcttcctagccggtggcctggatcccgcc
aatgtggcgcaagccgttacaaaggtacaacccatgggattggatgtgagctcgggggtc
gaggcggatggtgtcaagagccttgacaagattggtgcttttgtgcgggccgccaag

DBGET integrated database retrieval system