KEGG   Monosiga brevicollis: MONBRDRAFT_9140Help
Entry
MONBRDRAFT_9140   CDS       T01042                                 

Definition
hypothetical protein
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
mbr  Monosiga brevicollis
Brite
Enzymes [BR:mbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     MONBRDRAFT_9140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 331 aa AA seqDB search
MAEEAAVEEAAAEEQADIDRILEERGRGRKKEYLCSWMDGAEPQWVAARYLKGTVALDEW
RDAEDEVPEIREPEAEWRPKVEQLARWLQEAQRPCILLGAGISAPVLPTFRGAGGLWTKR
AKRQAASTEPLAPTAAHEALVALERKGHVDWLATQNYDNLTARSGFPMSKVSELHGNLFK
EVCERCGATYFRDYEVELATAVDHETGRHCEVADCSGRLRDNIIHFGEDLPAQDFERAEA
HFGASDLRIALGTSLAVEPAAGLLVQNRPRPRLRGARRRAKGRDTNTALTASPTRARVCI
VNLQPTPYDDQADLLVRATCDDVLRTLDELL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggaggcggcggtggaggaggcggcggcggaggagcaggcggatattgatcgg
atcttggaggagcgggggcggggaaggaagaaggagtacttgtgctcatggatggatggg
gctgagccacagtgggtggctgctcgatacctcaagggtacggttgctctggatgagtgg
cgtgatgcagaggacgaggtgccagagattcgggaaccggaagcggagtggcggcccaag
gttgagcagctggcccgctggctccaagaggcacagcgaccatgtattctgcttggcgct
ggcatctctgcccccgttcttcccacgtttcgtggcgccggaggcctctggaccaagcgg
gccaaacgtcaggctgcctcgaccgaacccctggccccaaccgcggcgcacgaggcactg
gtggccctcgagcgcaaaggccacgtcgactggctggcgacacaaaactatgataacctc
acggcccgcagcggctttcccatgtccaaagtttcggagctccatggcaaccttttcaag
gaggtgtgcgagcgctgtggcgccacctattttcgagattatgaggttgagctcgccact
gccgtggaccacgagacgggccgccactgcgaggtagccgactgttcagggcgcttgcgc
gataacattatccactttggcgaagatttgcctgctcaggactttgagcgagcagaggcc
cattttggagcctcggacttgcgcattgcactcggcacctcgctagccgtcgagccagcc
gccggcctcctggtccaaaatcgccctcgccctcgcctgcgaggtgcccgacgccgtgcc
aagggcagagacacgaataccgccctcactgcctctcctactcgagcacgcgtttgtatc
gtgaatcttcagcccactccttatgatgaccaggccgacttgctcgtgcgcgccacctgc
gatgacgtgttgcgaaccctggacgagctcttgtaa

DBGET integrated database retrieval system