KEGG   Monosiga brevicollis: MONBRDRAFT_9670Help
Entry
MONBRDRAFT_9670   CDS       T01042                                 

Definition
hypothetical protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
mbr  Monosiga brevicollis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1632 aa AA seqDB search
MREFCFGRPCNIDPWQARASRDSHCKAQVSRAQVSRAQVSRAQVSRARAFKDRVFKDRVF
KDRVFKDRVFKAQAWLHSAHRCSSLVARCKIILCKANPSKDNPFKDSLRPASRPSDSPRC
KVYSILPCQYNQSLVEAYHLTAYRVHPSLPWATLAWLASQCTAKVLFLAKAAMAYRQQQQ
HQQQMALQQQYRQQQQQQQLHQQQQLQQQQQLQQMQMPSTSMMPSTSMMPSTSMMPSTSM
MPATSMMPATSMMPANGGINPTMSANQRNASLRRPGAPSNLDLRAISNHSSPNLNPGALP
PQQQQQQQLPGQPPGMGMQGQPQRYLPQGSQPMVLPGGVVGRGAPMTNLGSRPGQAAPNG
LQLPNGSIASDASGGMSSLAGGNLGHDQLGALNATSMSGGATGMAPAHSETESKAALSRR
RAIQQQLMLLIHAYKCKLPDKDDRNVPPNGQVCSVRYCKVMKNVLRHMATCRDGKQCSVP
VKRPTVRFVIPCESRLTESDHQRARREIKQSSEISSQQRGHLLPSEPIVLCLFKKQRSRP
TIKLAQVLPPLRLRLLLLLLLLVQATDNESYYQKLAEKIYKIKKAKQDRQKRQATSRQIK
EWPRDELKHHFSPVLERLKGMSAAECFLRPVDPIELNIPDYFEIIKKPMDLSTIEDKLEK
GTYKDPWEFCDDMRLMFKNAWTYNPKNHVVYKFTNEVSSVFEDTIDLVMKRLRFCCGKEL
TFNPQVLYCSVKQICPIRRDEEYMKYDANLNSAFNCCMACWKETEGEKSTFTISAELTPD
QKEYVGLIACNGSRRERFQHDPRSSRGASPYAVPFVATFRIEVSRTHFTKAINNHIDYEE
FVTCAGCGRRHHQICVMYHASIHKEFICQACSKSNSATLSNPYPAHKLPRTKLSDYLEKR
VNDCLHDETVSSPPEARRVTVRVHSSRERGVVVKDNIRRYYADTEDPLPAEYPYRTKAIF
VYQESEGHEVCFFGLHVQEYGDDCPGPNRRRVYISYLDSVFFFEPSSLRTKVYHQLLIGY
LQYMAALGYMYAHIWACPPAAGDDYIFHCHPTEQKTPTPKRLSQWYAKMLKAAKEQNAIH
DFYDMYQYVCSRDIVRGRDLPYFEGDYWVNRLESLVQEIDQADGNDDGGMLSLDKVGKKK
SKKNTKGGKKKGGKGSKKQAADIDETLANRAWPEIEKNKSVFFVVQLHADPVNLPTFKAD
PDPDITCDFMDGREPFLQHCRENNHEFSTRRRALYSSMMMLYKLHTDESSGYTCNHCSTQ
ISSMDFRYHCTVCPDYDLCVKCHKEGVHKHEMKQLGLGMAPAVNADGQKMTRSQQSVETL
RRALLALHHAHQCKNPQCDTKACPQIKGMIEHMNTCNMRSSQCAQCKPLLTIVAHHAKVC
NNSNCQIPLCRQCKARFAENQRMALMRQQTQARRMNVMEHMNSTPAAAAPPAPAAATDAP
MTREALAIVLRHLPEKEQKHYQTAMLNQKKIKEAMAQLQAKIKAAPRDSAASKTDETHLK
KMHARYIELRAFILQLHKKGHALAVNAGALPQLATATPSVAGAPRATPAKAEPVSSAAAT
QPAVSGQGRNMSEKQRQVMIYVTKLAAMPPAQAEVELKRLPPNQAELLRNLIKARHEVRV
GWSGIIRDDDRR
NT seq 4899 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaattctgcttcggccgtccatgcaacatcgacccatggcaggccagagcctcc
agggacagtcattgcaaggctcaagtctccagggctcaagtctccagggctcaagtctcc
agggctcaagtctccagggctcgggccttcaaggatcgagtcttcaaggatcgagtcttc
aaggatcgagtcttcaaggatcgagtcttcaaggctcaagcttggctccacagcgcgcac
cgatgcagcagcctagtggcccgatgcaaaatcattctttgcaaggccaatccctccaag
gacaatcccttcaaggacagcctgcgaccagccagccgcccctcggacagcccgcgatgc
aaggtatacagcattctgccctgccagtacaatcagtcgctggtcgaggcctaccacctc
acagcctacagggtccacccgtctctaccttgggccaccctagcttggctcgccagccaa
tgcacagccaaggtgctgttcttagccaaggctgccatggcctaccgacaacagcaacag
caccaacaacaaatggctctgcagcaacaataccggcaacagcagcagcaacagcaacta
catcagcaacagcaactgcaacaacagcaacagttgcagcaaatgcaaatgccgtccacc
agcatgatgccgtccaccagcatgatgccgtccactagcatgatgccgtccaccagcatg
atgcccgccaccagcatgatgcccgccaccagcatgatgcccgccaacggtggcataaac
ccaaccatgagtgccaaccaacgtaatgcgtccctgcgccgacctggtgcaccttcaaat
ctggacctacgagccatctccaaccacagctcgcccaacctcaacccaggcgccttaccg
ccgcagcaacagcaacaacagcaactcccgggccagccgccgggcatgggcatgcagggc
caacctcagcgctaccttcctcaaggcagtcaaccaatggttctgccgggaggtgtggtc
ggccgtggtgcgccaatgacaaatcttggatctcgacctggtcaagccgctccaaatggc
ctgcagctgcccaatggctccattgccagtgatgccagcggtggcatgtcgagtttagct
ggcggtaacttgggccatgaccagctgggggccctcaacgcaacgtctatgagtggtggt
gccactggcatggcgcctgcgcattctgagactgaaagcaaggcggccttgtctcgccgc
cgggccatccagcagcagctcatgcttttaatccatgcctacaaatgcaagctacctgac
aaggatgatcgcaatgtaccgcccaatggacaggtttgttcggttcgctactgcaaagtc
atgaagaatgtgcttcgccacatggccacctgccgtgatggcaaacaatgctcggtacct
gtaaagaggccgactgtccgatttgtgatcccttgcgaaagccgcctcacggaaagcgac
caccaacgagcgaggcgcgagatcaaacagagctcagaaatctcctcacaacagaggggg
cacctcctgccaagcgagccaatcgtgctgtgcctgttcaaaaagcagcggtcaaggccg
acaataaaattagcccaagtgctgccgccgctgcggctgcggctgctgctgttgctgctg
ctgctcgtacaagccactgacaacgaaagctattatcaaaaattggcggagaaaatctac
aagatcaagaaagcaaagcaggatcgccagaagcgacaggcgaccagtcgccaaatcaag
gagtggccacgcgatgaactcaagcaccacttttcgcctgttttggagaggctcaagggc
atgtctgcggctgagtgctttttgcgccctgtcgaccctattgagcttaacattccagac
tattttgaaattatcaagaagcccatggacttgtcgacgattgaagataaactggagaaa
ggcacctacaaggacccgtgggagttttgcgatgatatgcgtctcatgttcaaaaacgct
tggacttacaatcccaagaaccacgttgtttacaagttcaccaatgaggtttccagcgtt
tttgaggataccatcgatttggtcatgaagcgtctgcgcttctgctgtggcaaagagctc
acattcaatcctcaagtactttactgctcggtgaaacaaatctgtccgattcgtcgcgac
gaggagtacatgaagtacgacgcaaatctcaactcggcattcaactgctgtatggcctgt
tggaaggagacagagggtgaaaagtccacttttaccatctcagctgagctgacacccgat
cagaaagagtacgtgggcctgatcgcctgcaacggttcaagaagagaacgtttccaacat
gatcctcgttcttcgcggggcgcctcaccctatgccgtgccttttgtcgctacctttaga
attgaagtcagccgtacgcactttaccaaagccatcaacaaccacattgattacgaagag
tttgtcacctgcgccggctgtggtcgccggcaccatcaaatttgcgtcatgtatcatgcc
agcattcacaaggagttcatttgccaagcctgcagcaagagcaactcggcgaccttgagc
aacccctaccctgcacacaaacttccgcgaaccaagctgagcgattatctcgagaagcgt
gtgaacgattgcctgcacgatgagaccgtgtcctcgccaccagaagccagacgtgtgaca
gtgcgcgtgcactcttctcgagagcgtggcgtggttgtcaaggacaacattcgccgctat
tatgccgacactgaggaccctctgcccgccgagtacccatatcgcaccaaagccatcttt
gtttatcaagaatcagagggtcatgaggtgtgcttttttgggctacatgttcaggaatac
ggtgacgattgtcccggcccaaaccgccggcgcgtttacattagctatctcgactctgtg
ttcttctttgagccgtccagcttgcgcaccaaggtctaccaccaactcttgattggttat
ttacagtatatggctgcgcttggctacatgtatgcgcatatttgggcctgcccccctgct
gcgggcgacgactacatctttcactgccatccgacagaacaaaagacgcccacgccgaag
cgtctttcgcagtggtacgcgaagatgctcaaggcagccaaggagcaaaatgccattcac
gacttttacgacatgtaccaatacgtgtgcagtcgtgacattgtccgtggccgcgattta
ccttattttgagggcgattactgggtcaatcgccttgagagccttgtacaggagatcgac
caggcagatggcaatgacgatgggggcatgctttccctggacaaggtgggcaagaagaaa
tcgaagaaaaacaccaagggcggcaaaaagaagggcggcaagggcagcaaaaagcaggcc
gccgacattgatgagactctggcaaaccgcgcatggcccgagattgagaagaacaagtct
gtttttttcgtggtgcagctccacgctgaccccgtcaacctaccaacattcaaggctgat
ccggacccagacatcacatgcgatttcatggatggccgagagcctttcttgcaacattgc
cgcgagaacaaccatgagtttagcacgcgccgacgagccctttattctagtatgatgatg
ctgtacaagctgcatactgatgagtcatcgggctacacctgcaaccactgctcaacgcaa
atcagtagcatggactttcgataccattgcacggtgtgccccgactatgacctttgcgtc
aagtgtcacaaggagggtgtgcacaagcatgagatgaagcagcttggtcttggcatggcc
cctgccgtcaatgccgatggtcaaaagatgacgcgatcacagcagagcgtcgaaacgttg
cgtcgcgctcttttggccctgcaccacgcccatcagtgtaaaaatccgcagtgtgacaca
aaggcttgcccacaaattaagggcatgattgagcacatgaacacgtgcaacatgcgcagc
tcgcagtgtgcgcagtgcaaaccgttgttgactatcgtggcgcaccatgccaaggtctgc
aacaattcgaactgtcagattcctctgtgtcgacaatgcaaggcccgttttgctgagaat
cagcgaatggccctcatgcgtcaacaaacccaggctcgtcgcatgaacgtcatggagcac
atgaatagcacaccggccgccgcagcaccgcccgcgcctgctgctgctactgatgcaccc
atgactcgcgaagccctagccatcgtcttgcgccatcttcccgaaaaggaacagaagcac
taccaaacggccatgctcaatcaaaagaaaatcaaggaagctatggctcagctgcaagca
aagataaaggcagcacctcgcgactctgccgcatccaagaccgacgagactcatttaaaa
aagatgcatgcgcgttatattgaactacgcgcgttcatcttgcagcttcacaagaaggga
catgcgcttgccgtcaacgcaggtgccttgccccagcttgctacggctacgccatcagtt
gcgggtgcacctcgcgctacgcccgccaaggcagagcccgtttcaagtgctgctgccacc
caacccgctgttagcggtcaaggccgcaatatgtccgagaagcagcgccaagtgatgatt
tatgtgaccaaactggctgcgatgcctccagcacaggctgaggtggagcttaaacgtcta
cctcccaaccaagccgagctgctgcgtaacctcataaaggcgcggcatgaggtacgagtc
ggatggtcgggcatcattcgcgatgatgaccgtcgttga

DBGET integrated database retrieval system