KEGG   Marinobacter sp. BSs20148: MRBBS_0324Help
Entry
MRBBS_0324        CDS       T02323                                 

Gene name
gabT
Definition
4-aminobutyrate aminotransferase GabT
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MRBBS_0324 (gabT)
   00650 Butanoate metabolism
    MRBBS_0324 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MRBBS_0324 (gabT)
   00280 Valine, leucine and isoleucine degradation
    MRBBS_0324 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MRBBS_0324 (gabT)
Enzymes [BR:mbs01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MRBBS_0324 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     MRBBS_0324 (gabT)
Amino acid related enzymes [BR:mbs01007]
 Aminotransferase (transaminase)
  Class III
   MRBBS_0324 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(341002..341730)
Genome map
AA seq 242 aa AA seqDB search
MNNAQLNELKNKYVANGAASPATHFADRAENSVIWDVDGNRIIDFAGGIGVLNIGHCHPK
VVAAVQAQVAKLMHTCQIVIPYAGYVKVAEKLSELAPVRGHGKVMLVNSGAEALENAVKI
ARAATGKNNVICFDGGYHGRTLFTMAMNGKVALYAGDFGTMPGNVIRAPYPVPSLGVSEK
EAIRRLHTTLKTDANPRERGLILIACGFYGNTLRFLMPVTIEEEVLNEGLAIVEACLAEL
TG
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacgcgcagttgaatgaactgaaaaacaaatacgtcgctaacggcgcggccagc
cccgccacacactttgcggatcgtgcagagaattctgtgatttgggatgtggatggcaat
cgcattatcgacttcgccggtggtatcggggtgttaaacattggccattgccacccgaaa
gttgtggcggcggtacaggcccaggtagcaaagctgatgcacacgtgtcagatcgtgatt
ccctatgcagggtatgtcaaagttgctgagaaactgagcgagttggctccggtgcgcggc
cacggtaaagttatgctggtgaactccggtgcagaagctctagaaaatgcggtcaagatt
gcgcgggctgcgaccggcaaaaacaacgttatctgctttgacggcggttaccacggccgt
acgctttttacgatggcaatgaacggcaaagttgcactctatgccggcgattttggcacc
atgcccggtaacgtgatccgtgcgccctacccggtaccttctcttggcgtcagcgaaaaa
gaagctattcgcagattgcacacgacgctcaagaccgatgctaacccgcgcgagagggga
ttgattctgattgcttgtggtttttacggcaacacgcttcgtttcctgatgcccgtcacg
attgaagaagaggtgctaaacgaaggcctggcaatcgttgaggcatgccttgcggagctt
acgggttag

DBGET integrated database retrieval system