KEGG   Marinobacter sp. BSs20148: MRBBS_0351Help
Entry
MRBBS_0351        CDS       T02323                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mbs00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
370816..372279
Genome map
AA seq 487 aa AA seqDB search
MTTIVAIDQGTTSTRAIALGSDGQPRLLLSREHQQFYPKPGWVEHDPRELMAILEDCCAA
AGECGDLAALGLDNQGESCLAWDARTGEAVTPVIVWQDARTEPAIEALKLQGAEAMVRQK
SGLPLDAYFSASKLGWMLAELPQVRRLHELGHLRMGTTDAFFRDRLTGRFETDVTTASRT
ALMNLETLNWDPELCRLFGVPLDALPVIGPSSGDLGLIRCGSKQVTLTASLVDQQASLYG
HGCRRPGDLKITFGTGAFLLGINHFDGSQLSNEATQTVGWQKSGEPPVFALEGGVYSAAS
ALNWCRGLGLFKDFSELAVTYTSSAASKGLVFVPALSGLACPHWDRSARGSWMGLSLHTT
AIDMVQAVLEGVAFRTAEVFLALERNQPVTGKISLDGRMTENAFFVQFLSNVLQRELSLS
SEPELTAIGTATLAAEATGIDSGYVARQQVITPGESCASLQELFTAARTATTAFAGSARE
PTSTILK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaatcgtcgccattgatcagggcaccacgagtacccgtgcgattgcgctcgga
agcgatggccagcccagactgcttctgagccgcgaacaccagcagttctacccaaagccc
gggtgggttgaacacgatccgcgggaactcatggcgatattagaggattgctgcgccgct
gccggagaatgcggtgatctcgccgccctggggctggacaatcagggtgagagctgtctt
gcctgggatgccagaaccggggaagccgtcaccccggttattgtctggcaagacgctcgc
accgagccggcaatcgaagcgcttaaactgcaaggcgccgaggcaatggtgcggcagaaa
agtggcttgccgcttgatgcctatttttcggcatcaaaactgggatggatgcttgcagag
ctaccgcaagttcggcgtttgcacgaactcggccacctgcggatgggcacgacagatgct
ttttttcgggaccggctgaccgggcgcttcgaaacagacgtgacgaccgcatcaagaacg
gcgctgatgaatctcgaaaccctgaactgggacccggagttgtgccgtctgtttggcgtg
cctctagacgcgctaccggtcatcggcccgagctctggcgatctgggcctgattcggtgt
ggctcaaagcaggtgactctcaccgcaagcctggtcgatcagcaggcatctctctatggc
cacggctgtcgtcgtccgggtgacctcaaaataacttttgggacaggtgcttttctactt
ggaatcaatcactttgacggtagccagctcagcaacgaagcaacgcagaccgttggctgg
cagaaatccggagagccgccagtctttgcgttggagggcggtgtgtattcggcagcctcg
gcgctgaactggtgccgcggtttagggctgtttaaggatttctcggagctggcggtcaca
tatacaagttcggcagcctccaaagggctggtgttcgtgcctgccctttctggtcttgcc
tgcccacattgggatagaagtgccagggggagctggatggggctgtcgctgcatacaacg
gcgattgatatggtgcaggccgttctggagggtgttgcttttcgcaccgcggaagtgttt
ctggcccttgagcgcaaccaacccgtcaccggaaaaatttcacttgatggccggatgacc
gagaatgcttttttcgtgcagtttttatcgaatgtgctgcagcgggaactgtcgttatcg
tctgagccagagctgaccgctataggcactgcaaccctggccgctgaagccaccggaata
gattcaggctacgtggctcgtcagcaagttattaccccgggcgagtcttgcgcttcgctt
caggaattgttcactgcggcccgaacggctactacagcgttcgcaggatcggcccgggaa
cccacctcgacaattttgaaatga

DBGET integrated database retrieval system