KEGG   Marinobacter sp. BSs20148: MRBBS_0407Help
Entry
MRBBS_0407        CDS       T02323                                 

Definition
hypothetical protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MRBBS_0407
Enzymes [BR:mbs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     MRBBS_0407
    3.5.1.-  
     MRBBS_0407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
431457..432095
Genome map
AA seq 212 aa AA seqDB search
MTCIAAFDVDAQKTFTPLCPNELPVPEGDQIVDELNAQAELAAFRVGSRDAHPSNAQWIA
DTPEDVFSKVEGENIDIKWPRHAELGTVGFELLDGLPHPVTGYDFMVNKGLDPDCHPYGA
CYHDLADTVTTGVIEFLKSKGVTVVIVGGLALDYCVAKTVLQLRNADFQVIVNLAAVRGI
AEDSVERAMTDMKQAGAEFANNADDVKRLLPR
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgacctgcattgccgcgtttgatgtagacgcacagaagacgttcacgcctctgtgcccg
aatgaactgccggtaccggaaggtgaccaaatcgtcgatgagctgaacgctcaggccgag
ctggccgcttttcgggttggttcccgggatgctcacccctcaaatgctcagtggatcgcg
gacacgcccgaagacgttttcagtaaggttgagggcgaaaatattgacattaagtggcct
cggcacgccgaactgggaactgtaggtttcgagttactggacggcctgccgcaccccgtc
accggctatgactttatggtgaacaaaggtctggacccggactgccacccatacggtgcc
tgctatcacgatttggctgataccgtgaccacgggtgttatcgagttcctcaaaagcaag
ggcgtgaccgttgtcattgttggtggtcttgcgcttgattactgcgtcgccaaaaccgtt
ctgcagttaagaaacgccgactttcaggtcatcgtcaatctggccgccgtccggggtatc
gctgaggacagcgttgagcgagcgatgaccgacatgaagcaggccggtgctgagttcgcc
aacaatgcggacgacgtcaagcgattgctgccacggtag

DBGET integrated database retrieval system