KEGG   Marinobacter sp. BSs20148: MRBBS_0440Help
Entry
MRBBS_0440        CDS       T02323                                 

Gene name
fdhA
Definition
(GenBank) Glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
mbs00625  Chloroalkane and chloroalkene degradation
mbs00680  Methane metabolism
mbs01100  Metabolic pathways
mbs01120  Microbial metabolism in diverse environments
mbs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    MRBBS_0440 (fdhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MRBBS_0440 (fdhA)
Enzymes [BR:mbs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     MRBBS_0440 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C AdoHcyase_NAD FAD_binding_2 PALP IlvN FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFP29378
UniProt: M1FG96
Position
463036..464235
Genome map
AA seq 399 aa AA seqDB search
MSDNRGVVYIGPGKVDVQSIPFPKLENPQGRRIGHGVLLKVITTNICGSDQHMVRGRTSA
LAGLVLGHEITGEVIEIGSDVENFKVGDLASVPFNVACGRCRTCKEQDTGVCLTVNPSRA
GGAYGYVDMGGWVGGQADYVMVPYADFNLLKLPHRDLAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYIAGAGPVGLAAAASSRLLGAAVVIVGDVNPTRLTHAKSQGFEVVDLSQD
ASLGDQIAELLGIPEVDCAVDAVGFEARGHGHDGVQEEAPAIVLNSLMEITRAAGKLGIP
GLYVTEDPGSADTAAQKGNLSLRFGLGWAKSHSFHTGQTPVMKYNRQLMQAIMWDRIKIA
DVVGVEVISLNDAPLGYGEFDAGVPKKFVIDPHNSLKLA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaatcgcggtgtagtttacattggtccgggcaaggttgacgttcagtcaatt
ccgttcccgaaactggagaacccgcagggccgcaggatcggtcacggtgtattgctgaaa
gtgatcacgaccaacatctgtgggtcggaccagcacatggtccgcggccgcacatcggcg
cttgcaggattggtgctgggtcacgagattaccggcgaagtgattgaaatcggctccgat
gtcgagaacttcaaggttggcgacctggcgtcggtaccgttcaacgtagcgtgcgggcgc
tgccgaacctgcaaggagcaggacaccggggtctgcctcaccgtcaacccgtcgcgcgct
ggcggcgcttacggttatgtggatatggggggatgggtcggtggtcaggccgactatgtg
atggtgccctatgccgacttcaatctgctgaaactgccgcaccgcgatcttgcaatggaa
aagattcgggacctcacctgtctctccgacattttgcccacaggctatcacggcgcggta
acagcaggcgtcggtccgggtagtacggtctatatcgccggtgcaggaccggtcgggctc
gctgctgcagcctcgtcgcggttgctgggcgcggcggtcgtcatcgtcggcgacgtcaat
ccgacccgcctgacccatgcgaaatctcaggggttcgaggtggtagacctgtcgcaggac
gcttctttgggtgatcagatcgctgaactgctgggcatacccgaggtggattgtgcggta
gacgccgtcgggttcgaggctcgcggtcatgggcatgacggcgttcaggaagaggccccg
gcgattgtgctcaattcgctgatggagatcacccgtgctgcaggcaagctgggtattccc
ggcctgtatgtcaccgaggatccgggctctgcggatacagccgcccagaagggcaacctg
agcctgcgttttggccttggctgggccaagtcccatagcttccacaccggccagacaccg
gtgatgaagtacaaccgccagttgatgcaggccatcatgtgggatcgtatcaagatagcg
gatgtcgtcggggtcgaggttatctcgttgaacgatgcgccgctcggttacggtgagttt
gatgcgggcgtgcccaaaaaattcgttatcgatccgcacaactcgctcaagctggcataa

DBGET integrated database retrieval system