KEGG   Marinobacter sp. BSs20148: MRBBS_0440Help
Entry
MRBBS_0440        CDS       T02323                                 

Gene name
fdhA
Definition
glutathione-independent formaldehyde dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MRBBS_0440 (fdhA)
  Energy metabolism
   00680 Methane metabolism
    MRBBS_0440 (fdhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MRBBS_0440 (fdhA)
Enzymes [BR:mbs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     MRBBS_0440 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
463036..464235
Genome map
AA seq 399 aa AA seqDB search
MSDNRGVVYIGPGKVDVQSIPFPKLENPQGRRIGHGVLLKVITTNICGSDQHMVRGRTSA
LAGLVLGHEITGEVIEIGSDVENFKVGDLASVPFNVACGRCRTCKEQDTGVCLTVNPSRA
GGAYGYVDMGGWVGGQADYVMVPYADFNLLKLPHRDLAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYIAGAGPVGLAAAASSRLLGAAVVIVGDVNPTRLTHAKSQGFEVVDLSQD
ASLGDQIAELLGIPEVDCAVDAVGFEARGHGHDGVQEEAPAIVLNSLMEITRAAGKLGIP
GLYVTEDPGSADTAAQKGNLSLRFGLGWAKSHSFHTGQTPVMKYNRQLMQAIMWDRIKIA
DVVGVEVISLNDAPLGYGEFDAGVPKKFVIDPHNSLKLA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaatcgcggtgtagtttacattggtccgggcaaggttgacgttcagtcaatt
ccgttcccgaaactggagaacccgcagggccgcaggatcggtcacggtgtattgctgaaa
gtgatcacgaccaacatctgtgggtcggaccagcacatggtccgcggccgcacatcggcg
cttgcaggattggtgctgggtcacgagattaccggcgaagtgattgaaatcggctccgat
gtcgagaacttcaaggttggcgacctggcgtcggtaccgttcaacgtagcgtgcgggcgc
tgccgaacctgcaaggagcaggacaccggggtctgcctcaccgtcaacccgtcgcgcgct
ggcggcgcttacggttatgtggatatggggggatgggtcggtggtcaggccgactatgtg
atggtgccctatgccgacttcaatctgctgaaactgccgcaccgcgatcttgcaatggaa
aagattcgggacctcacctgtctctccgacattttgcccacaggctatcacggcgcggta
acagcaggcgtcggtccgggtagtacggtctatatcgccggtgcaggaccggtcgggctc
gctgctgcagcctcgtcgcggttgctgggcgcggcggtcgtcatcgtcggcgacgtcaat
ccgacccgcctgacccatgcgaaatctcaggggttcgaggtggtagacctgtcgcaggac
gcttctttgggtgatcagatcgctgaactgctgggcatacccgaggtggattgtgcggta
gacgccgtcgggttcgaggctcgcggtcatgggcatgacggcgttcaggaagaggccccg
gcgattgtgctcaattcgctgatggagatcacccgtgctgcaggcaagctgggtattccc
ggcctgtatgtcaccgaggatccgggctctgcggatacagccgcccagaagggcaacctg
agcctgcgttttggccttggctgggccaagtcccatagcttccacaccggccagacaccg
gtgatgaagtacaaccgccagttgatgcaggccatcatgtgggatcgtatcaagatagcg
gatgtcgtcggggtcgaggttatctcgttgaacgatgcgccgctcggttacggtgagttt
gatgcgggcgtgcccaaaaaattcgttatcgatccgcacaactcgctcaagctggcataa

DBGET integrated database retrieval system