KEGG   Marinobacter sp. BSs20148: MRBBS_0471Help
Entry
MRBBS_0471        CDS       T02323                                 

Definition
Outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:mbs00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:mbs00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mbs00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:mbs00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(487824..488981)
Genome map
AA seq 385 aa AA seqDB search
MLFTSALTIIRQRRHVLATAISAALYTLAWAPAAGAQTDAEPIAGQPLSAQDCALIRDGL
QRLACFDEVYQPDLARDNASTEQRQRIESATEALPPIKRNIKGGLNSPGADDETAVMSSI
LDRYLEAEEALFSFSGSFIRHRPNYILPVTWSDHPNQAPTSPRLGVTGYDYDLKQEEAKY
QISFKVPLFTGLMDKRTTLWFGYTQKSFWQLYNQDESAPFRETNYEPELFLRYQPDWNIG
PGRLDTLYVGINHQSNGQAEPRSRSWNRIVGMGTYTYKRWLFMVKPWIRLPEGSTDDNND
IESYLGHGSYHAVYKLTEDRTFSLKLLNNLRISDNRTSVEFGYSFPIGEAIKGFVHYYNG
YGESLIDYNERIQRVGVGIMLNDWL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgctattcacttctgcgttaacaattatccggcagcgacgccacgtgttggcaacggca
atatccgccgcattgtacactttggcctgggcgcctgcggccggtgcccaaaccgacgct
gagcccatagcgggtcagcctctgtccgcccaagactgcgcactgattcgcgatgggttg
cagcgcctggcctgtttcgatgaggtttaccagcctgatctagcccgcgacaacgccagc
accgagcaacggcagcggatagaaagcgctaccgaagcactgccgccaatcaagcggaac
ataaaaggaggactgaatagccccggggcagacgacgaaaccgccgtgatgtcgtcgatt
ctggaccgctacctggaagcagaagaggccctgttttcgttctctggcagttttattcgc
caccgcccaaattacattttgccagtcacctggtccgaccacccaaatcaggcacctaca
agtccgcgcctgggcgtgaccggctacgattacgaccttaagcaggaagaagccaagtac
cagatcagcttcaaagttccgctattcaccggccttatggataaacgcactaccctttgg
ttcggctacacccagaagtctttctggcagctttacaatcaggatgagtccgcgccgttt
cgtgaaaccaactacgagcctgaactattcctgcgctaccaacccgattggaacattggg
ccaggccgcctggatacgttgtatgtgggcattaaccaccagtcaaacggtcaggccgag
ccgcgctcgcgcagttggaaccgcattgttggcatgggaacttacacttacaagcgctgg
ctgttcatggtgaaaccttggatacgcttgccagagggcagcaccgacgacaacaacgat
attgaaagctatctgggccatggcagttaccacgcagtttacaagctgacggaagaccgc
accttctcattgaagctgctgaacaacctgcgcatctcagacaacagaacctcggtggag
tttggctatagcttccccatcggcgaggccatcaaaggcttcgtgcattattacaacggt
tacggtgagagcctaattgactacaacgagcgcattcagagggtcggcgtgggaattatg
ctgaacgactggctttaa

DBGET integrated database retrieval system