KEGG   Marinobacter sp. BSs20148: MRBBS_0509Help
Entry
MRBBS_0509        CDS       T02323                                 

Gene name
pleD
Definition
(GenBank) Response regulator PleD
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
mbs  Marinobacter sp. BSs20148
Brite
Enzymes [BR:mbs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     MRBBS_0509 (pleD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
525392..526780
Genome map
AA seq 462 aa AA seqDB search
MSPELSWKDQYLRELDAAEHREQQWQQHRTLLERMLVRTSLGLKGQSGELDQLLDNVRDQ
VRSPAIDVEHWELLQTKIDCQMVLLEQAEVASQGSGASPAAGSMDLGRDGDRDRLRIARR
VGQLVEQIVSDIPISADAEKKARALQQILLYSEDWSVLRKCLRDVAELVMMAIKQCRAQF
DEFIQQLDDRLAVLRQSFVAHTSAQSGRLSASEALGQDLQGGLKRLSQHIQSSNNLYQLK
HSVTGHLDDIAQSVVQFRKRESDREKALATQLEALQQKIVTMETESELMREQVLKERRRA
NTDMLTQLPNRDSWHDRLQLEVERWQRYKGEMTIAIVDIDLFKRINDSYGHKAGDRVLQL
LARELKKGLRSTDFIARIGGEEFVVLLPETTGIQAKQVIDGLRASVAKLPFHCGNQPVTI
TFSAGIASIRSGDDEDTLFERADRTLYIAKNAGRNQVKISTD
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagcccagagttgtcttggaaagaccaatatctacgggagttggatgctgccgaacac
cgtgagcaacaatggcaacagcaccgcacgttgcttgagcggatgttggtgcggaccagc
ttgggtctgaagggacagtctggcgagcttgaccaactattggataatgttcgtgaccaa
gtgcgtagccccgctattgacgttgagcactgggagttgttgcaaacaaagattgattgc
cagatggtgcttcttgaacaagcggaagttgcttcacaaggttctggtgcaagccctgct
gcaggttctatggacctgggccgggacggcgaccgcgaccgcctgcgtattgcccgccgt
gttggccagttagtggaacaaatcgtcagcgatataccgataagtgcagacgcggaaaaa
aaggcccgcgctctgcagcagattctgctttatagcgaagactggagcgtgttgcgcaaa
tgtctgcgcgatgtggctgaattggtgatgatggccattaagcaatgccgcgcccagttt
gacgaatttattcaacagcttgacgatcgcctggccgtgctgcgccagagctttgtagcg
catacgtccgcgcaaagcggccggctgagtgcttcagaggcgttgggccaagatttgcag
ggcgggctaaagcgcctgagccagcacattcaaagcagtaacaacctctatcagttgaaa
cattctgtgacgggtcacctggacgacatagcccagtcagtagtccagtttcgcaaacgc
gaaagtgaccgtgaaaaagccctggcgactcagttggaagctctgcagcagaaaatcgtc
accatggaaaccgagtctgagctgatgcgcgaacaggttcttaaagagcgccgtcgcgcc
aataccgatatgctcacccagctccccaaccgtgactcctggcacgaccgcctgcaactt
gaggtcgagcggtggcagcgttataaaggtgaaatgacaattgcaatagttgatatcgac
ctcttcaagcgcattaacgactcttatggccataaagcgggcgatagggtgttgcagctg
ctggcgcgggagttgaaaaaaggactgcgctcgacagattttatcgcccgtattggcggc
gaggaatttgtggtattgctaccggaaaccaccggtatccaggccaaacaagtgatagac
ggcttacgcgccagtgtcgcaaaattgccgtttcattgtggcaatcagccggttaccatt
actttttcggcagggattgcgagcatcagaagtggcgatgacgaagacactctgttcgaa
cgcgccgaccgcacgctttatatcgccaagaatgccggccgcaaccaggttaagatcagc
acggactaa

DBGET integrated database retrieval system