KEGG   Marinobacter sp. BSs20148: MRBBS_0793Help
Entry
MRBBS_0793        CDS       T02323                                 

Gene name
dhfrIII
Definition
dihydrofolate reductase type 3
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MRBBS_0793 (dhfrIII)
   00670 One carbon pool by folate
    MRBBS_0793 (dhfrIII)
Enzymes [BR:mbs01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MRBBS_0793 (dhfrIII)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
841148..841663
Genome map
AA seq 171 aa AA seqDB search
MQKALIVAMAQNRVIGRNNNLPWYLPGDLKYFKQATMGKPIIMGRKTWDSIGRPLPGRMN
VVISRNEKWQAPVGTTAATTLKAALKKAEAQAELDGIKEVMVIGGGQIYAEALPLVDRIY
MTLVHADVEGDAYFPEVNWEEWNEVGREDFSASDNNPYNYSFVVYQRMASD
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagcactcattgtcgccatggctcaaaatcgcgtcatcggccgtaacaacaac
ttgccatggtacctgcctggtgacctgaaatacttcaaacaagccaccatgggcaagcct
attatcatgggccgcaaaacatgggactccattggtcgtcccttgccaggacgcatgaac
gtggttatctcacgcaatgaaaaatggcaggcaccggtaggcaccactgcagccacaacg
ctgaaagcagcactaaaaaaagccgaagcacaggcagaactggatggtattaaagaagtc
atggtgattggcggcgggcaaatctacgccgaagcgctaccgctggtggatcgtatttac
atgaccctagtgcacgcagacgtggagggtgatgcttactttccggaagtaaattgggaa
gagtggaacgaagtcggacgcgaagatttctccgcgtccgacaacaatccttacaactac
agcttcgtagtgtatcagcgcatggcgtcagactga

DBGET integrated database retrieval system