KEGG   Marinobacter sp. BSs20148: MRBBS_0815Help
Entry
MRBBS_0815        CDS       T02323                                 

Gene name
pfp
Definition
(GenBank) Pyrophosphate--fructose 6-phosphate 1-phosphotransferase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
mbs00010  Glycolysis / Gluconeogenesis
mbs00030  Pentose phosphate pathway
mbs00051  Fructose and mannose metabolism
mbs00052  Galactose metabolism
mbs00680  Methane metabolism
mbs01100  Metabolic pathways
mbs01110  Biosynthesis of secondary metabolites
mbs01120  Microbial metabolism in diverse environments
mbs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MRBBS_0815 (pfp)
   00030 Pentose phosphate pathway
    MRBBS_0815 (pfp)
   00051 Fructose and mannose metabolism
    MRBBS_0815 (pfp)
   00052 Galactose metabolism
    MRBBS_0815 (pfp)
  Energy metabolism
   00680 Methane metabolism
    MRBBS_0815 (pfp)
Enzymes [BR:mbs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MRBBS_0815 (pfp)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     MRBBS_0815 (pfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AFP29753
UniProt: M1FH76
Position
complement(862936..864198)
Genome map
AA seq 420 aa AA seqDB search
MAIKNAFYAQSGGVTAVINASACGVIQTARRHPDKIGKVYAGRNGILGALKEELIDTSLE
SDGAIAALMHTPGGAFGSCRHKLKNISENRREYERLIEVFRAHDIGYFFYNGGGDSQDTA
YKVSQISEKMGYPITCIGIPKTVDNDLPFTDCCPGFGSVAKYIAISTMEASLDIKSMCET
STKVFILEVMGRHAGWIAASGGLAGQGEGEPPHIILFPEIPFDREAFLARVDFCVKEYGY
CVIVASEGAQYEDGRFLAEAGARDAFGHTQLGGVAPALANLMKQALGYKYHWAVADYLQR
SARHIASATDVEQAYTVGKAAVEMAIAGKQALMPIIVREQAKPYRWRVGEAPLSEVANQE
KKMPIHYITDDGFGITQDCRDYLSPLIQGESFPPFENGLPKVAKLKNQLVEKRLKTAFEL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggccattaaaaacgcattctatgcacaatccggtggtgttaccgccgttataaacgcc
agcgcctgtggcgttattcagaccgcccgccggcacccggataaaatcggcaaggtgtat
gccgggcgcaacggtattctcggtgcgttgaaagaagaactgatcgataccagtctggag
tccgatggcgccattgccgcactgatgcatacccctggcggtgcgtttggatcgtgtcgc
cacaagcttaaaaatatctccgaaaaccgccgcgaatacgagcgcttaattgaagtgttc
cgcgcccacgacatcgggtatttcttctataacggcggcggcgattcgcaagacaccgct
tacaaggtatcgcagatcagcgaaaaaatgggctatcctattacctgcatcggtataccc
aagaccgttgataacgatctgcccttcaccgattgctgcccgggctttggctcggttgcc
aagtacattgccatctccacgatggaagccagccttgacatcaaatccatgtgcgagacc
tccaccaaagtgttcattctggaggtgatgggtcgccacgccggctggattgctgcatca
ggcgggcttgccggtcagggcgaaggtgagccgccgcacattattttgttcccggaaatt
ccgtttgatcgcgaggccttcctggcccgggtggacttttgcgtgaaggaatacggttat
tgcgtgattgttgcgtctgaaggcgctcaatatgaagacggccgctttctggctgaagcc
ggggccagagacgcctttggccacacccaattaggcggcgttgcgccagcgctggcaaat
ctgatgaagcaggcactgggctacaagtaccactgggccgtagctgattacctgcagcga
agtgcgcgccatatcgcctcagccaccgacgtagaacaggcctacaccgtcggcaaggca
gcggtagaaatggcgattgccggcaagcaggcgctaatgcccatcatcgttcgcgagcag
gccaagccttatcgctggagagtgggcgaggcaccgctgagcgaagtggctaaccaggaa
aagaaaatgccgattcactacatcaccgatgacggcttcggcattacccaagactgccgc
gactacttgagcccactgattcagggcgaaagttttccaccttttgagaacggcttgcca
aaagtagccaaattgaaaaaccaattggtggaaaaacgccttaaaaccgcattcgagctc
taa

DBGET integrated database retrieval system