KEGG   Marinobacter sp. BSs20148: MRBBS_0815Help
Entry
MRBBS_0815        CDS       T02323                                 

Gene name
pfp
Definition
pyrophosphate--fructose 6-phosphate 1-phosphotransferase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MRBBS_0815 (pfp)
   01230 Biosynthesis of amino acids
    MRBBS_0815 (pfp)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MRBBS_0815 (pfp)
   00030 Pentose phosphate pathway
    MRBBS_0815 (pfp)
   00051 Fructose and mannose metabolism
    MRBBS_0815 (pfp)
   00052 Galactose metabolism
    MRBBS_0815 (pfp)
  Energy metabolism
   00680 Methane metabolism
    MRBBS_0815 (pfp)
Enzymes [BR:mbs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MRBBS_0815 (pfp)
Protein phosphatases and associated proteins [BR:mbs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MRBBS_0815 (pfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(862936..864198)
Genome map
AA seq 420 aa AA seqDB search
MAIKNAFYAQSGGVTAVINASACGVIQTARRHPDKIGKVYAGRNGILGALKEELIDTSLE
SDGAIAALMHTPGGAFGSCRHKLKNISENRREYERLIEVFRAHDIGYFFYNGGGDSQDTA
YKVSQISEKMGYPITCIGIPKTVDNDLPFTDCCPGFGSVAKYIAISTMEASLDIKSMCET
STKVFILEVMGRHAGWIAASGGLAGQGEGEPPHIILFPEIPFDREAFLARVDFCVKEYGY
CVIVASEGAQYEDGRFLAEAGARDAFGHTQLGGVAPALANLMKQALGYKYHWAVADYLQR
SARHIASATDVEQAYTVGKAAVEMAIAGKQALMPIIVREQAKPYRWRVGEAPLSEVANQE
KKMPIHYITDDGFGITQDCRDYLSPLIQGESFPPFENGLPKVAKLKNQLVEKRLKTAFEL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggccattaaaaacgcattctatgcacaatccggtggtgttaccgccgttataaacgcc
agcgcctgtggcgttattcagaccgcccgccggcacccggataaaatcggcaaggtgtat
gccgggcgcaacggtattctcggtgcgttgaaagaagaactgatcgataccagtctggag
tccgatggcgccattgccgcactgatgcatacccctggcggtgcgtttggatcgtgtcgc
cacaagcttaaaaatatctccgaaaaccgccgcgaatacgagcgcttaattgaagtgttc
cgcgcccacgacatcgggtatttcttctataacggcggcggcgattcgcaagacaccgct
tacaaggtatcgcagatcagcgaaaaaatgggctatcctattacctgcatcggtataccc
aagaccgttgataacgatctgcccttcaccgattgctgcccgggctttggctcggttgcc
aagtacattgccatctccacgatggaagccagccttgacatcaaatccatgtgcgagacc
tccaccaaagtgttcattctggaggtgatgggtcgccacgccggctggattgctgcatca
ggcgggcttgccggtcagggcgaaggtgagccgccgcacattattttgttcccggaaatt
ccgtttgatcgcgaggccttcctggcccgggtggacttttgcgtgaaggaatacggttat
tgcgtgattgttgcgtctgaaggcgctcaatatgaagacggccgctttctggctgaagcc
ggggccagagacgcctttggccacacccaattaggcggcgttgcgccagcgctggcaaat
ctgatgaagcaggcactgggctacaagtaccactgggccgtagctgattacctgcagcga
agtgcgcgccatatcgcctcagccaccgacgtagaacaggcctacaccgtcggcaaggca
gcggtagaaatggcgattgccggcaagcaggcgctaatgcccatcatcgttcgcgagcag
gccaagccttatcgctggagagtgggcgaggcaccgctgagcgaagtggctaaccaggaa
aagaaaatgccgattcactacatcaccgatgacggcttcggcattacccaagactgccgc
gactacttgagcccactgattcagggcgaaagttttccaccttttgagaacggcttgcca
aaagtagccaaattgaaaaaccaattggtggaaaaacgccttaaaaccgcattcgagctc
taa

DBGET integrated database retrieval system