KEGG   Marinobacter sp. BSs20148: MRBBS_0815Help
Entry
MRBBS_0815        CDS       T02323                                 

Gene name
pfp
Definition
(GenBank) Pyrophosphate--fructose 6-phosphate 1-phosphotransferase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MRBBS_0815 (pfp)
   00030 Pentose phosphate pathway
    MRBBS_0815 (pfp)
   00051 Fructose and mannose metabolism
    MRBBS_0815 (pfp)
   00052 Galactose metabolism
    MRBBS_0815 (pfp)
  Energy metabolism
   00680 Methane metabolism
    MRBBS_0815 (pfp)
Enzymes [BR:mbs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MRBBS_0815 (pfp)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     MRBBS_0815 (pfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(862936..864198)
Genome map
AA seq 420 aa AA seqDB search
MAIKNAFYAQSGGVTAVINASACGVIQTARRHPDKIGKVYAGRNGILGALKEELIDTSLE
SDGAIAALMHTPGGAFGSCRHKLKNISENRREYERLIEVFRAHDIGYFFYNGGGDSQDTA
YKVSQISEKMGYPITCIGIPKTVDNDLPFTDCCPGFGSVAKYIAISTMEASLDIKSMCET
STKVFILEVMGRHAGWIAASGGLAGQGEGEPPHIILFPEIPFDREAFLARVDFCVKEYGY
CVIVASEGAQYEDGRFLAEAGARDAFGHTQLGGVAPALANLMKQALGYKYHWAVADYLQR
SARHIASATDVEQAYTVGKAAVEMAIAGKQALMPIIVREQAKPYRWRVGEAPLSEVANQE
KKMPIHYITDDGFGITQDCRDYLSPLIQGESFPPFENGLPKVAKLKNQLVEKRLKTAFEL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggccattaaaaacgcattctatgcacaatccggtggtgttaccgccgttataaacgcc
agcgcctgtggcgttattcagaccgcccgccggcacccggataaaatcggcaaggtgtat
gccgggcgcaacggtattctcggtgcgttgaaagaagaactgatcgataccagtctggag
tccgatggcgccattgccgcactgatgcatacccctggcggtgcgtttggatcgtgtcgc
cacaagcttaaaaatatctccgaaaaccgccgcgaatacgagcgcttaattgaagtgttc
cgcgcccacgacatcgggtatttcttctataacggcggcggcgattcgcaagacaccgct
tacaaggtatcgcagatcagcgaaaaaatgggctatcctattacctgcatcggtataccc
aagaccgttgataacgatctgcccttcaccgattgctgcccgggctttggctcggttgcc
aagtacattgccatctccacgatggaagccagccttgacatcaaatccatgtgcgagacc
tccaccaaagtgttcattctggaggtgatgggtcgccacgccggctggattgctgcatca
ggcgggcttgccggtcagggcgaaggtgagccgccgcacattattttgttcccggaaatt
ccgtttgatcgcgaggccttcctggcccgggtggacttttgcgtgaaggaatacggttat
tgcgtgattgttgcgtctgaaggcgctcaatatgaagacggccgctttctggctgaagcc
ggggccagagacgcctttggccacacccaattaggcggcgttgcgccagcgctggcaaat
ctgatgaagcaggcactgggctacaagtaccactgggccgtagctgattacctgcagcga
agtgcgcgccatatcgcctcagccaccgacgtagaacaggcctacaccgtcggcaaggca
gcggtagaaatggcgattgccggcaagcaggcgctaatgcccatcatcgttcgcgagcag
gccaagccttatcgctggagagtgggcgaggcaccgctgagcgaagtggctaaccaggaa
aagaaaatgccgattcactacatcaccgatgacggcttcggcattacccaagactgccgc
gactacttgagcccactgattcagggcgaaagttttccaccttttgagaacggcttgcca
aaagtagccaaattgaaaaaccaattggtggaaaaacgccttaaaaccgcattcgagctc
taa

DBGET integrated database retrieval system