KEGG   Marinobacter sp. BSs20148: MRBBS_0856Help
Entry
MRBBS_0856        CDS       T02323                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mbs00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(901437..902294)
Genome map
AA seq 285 aa AA seqDB search
MTTITLPAPAKINLFLHINGRRADGYHLIQTLFQFLDYGDELTFELTPGKPGVRLAQSMP
GVADADNLIIKAAHALAGDALAQLSGVTISICKKLPMGGGLGGGSSNAATTLLALNYLWQ
LGHDEDALAELGLNLGADVPVFVRGHAAIGEGVGEQLTPANPPQDWFVVLKPECNIQTTK
IFSAKGLTRNTPKMTMAPAFEGDASGYKNDCEATVRKLYPDVAESLDWLSQFGPARLTGT
GACIFGRFPTESAARIIWESRPSGIKGFVARGVNHSPLHQKLAEL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaatcaccctgccggcgccggcaaagattaatcttttcttgcacatcaatggc
cgccgcgctgacggttaccacctgattcaaaccctgttccagtttctggactatggcgat
gaactgacctttgagctgactcccggtaagcccggcgtgcgcctggcgcaatcgatgccc
ggggtagccgatgccgacaacctgatcattaaggctgctcacgcattggccggggatgcg
ctggcgcagctgtccggtgttaccatcagtatttgtaaaaaactgcccatgggcggtggc
ttgggcggcggtagttctaacgccgcaaccactctgctggcgttgaattacctgtggcag
cttggccatgacgaagacgctctggcagaactgggcctgaatttgggcgccgatgtaccg
gtttttgtgcgcggccacgcagccatcggcgaaggcgtcggtgaacagctcacacccgca
aacccaccacaagactggtttgtggtgctaaaacccgaatgtaatattcaaaccaccaag
attttttcggcaaaagggttgacaagaaacactccaaaaatgacaatggcgcccgctttt
gagggagacgcctcggggtacaaaaacgactgtgaagcaacggttcggaaactgtatcct
gacgtcgctgaaagtctagattggctttcacaattcggacctgcgagattaactggaaca
ggggcttgcattttcggacgtttcccgacagaatccgcagcccggatcatctgggaaagt
agaccctctggcatcaaggggttcgtagctagaggggtgaatcattcacctctacaccag
aaactagcagagctataa

DBGET integrated database retrieval system