KEGG   Marinobacter sp. BSs20148: MRBBS_0946Help
Entry
MRBBS_0946        CDS       T02323                                 

Gene name
dsbC
Definition
Thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
mbs  Marinobacter sp. BSs20148
Brite
Enzymes [BR:mbs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MRBBS_0946 (dsbC)
Secretion system [BR:mbs02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   MRBBS_0946 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
993636..994385
Genome map
AA seq 249 aa AA seqDB search
MSFSMPVISRFIAVALFSGLLLPAFVAAADIEERITQRLQTAVPGLQIESMAPAKAPGIY
EVRTNSGQIVYATEDAEYLFIGDLVKLESAGYVNLTEQARTSQRRQTINEHAKNGGLIQY
AAKGEQKAVIDVFTDIDCGYCRKLHGEMDELNELGITVNYFGFPRSGPGTESFRKYVSVW
CAKDPQAAMNKAKSGGSVSSADCANPVAEQYNLGRLVGVTGTPAIVLEDGTLMPGYVPAK
TLARSLGIL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtctttttctatgcctgttatttcccgctttattgccgttgctctgttcagtggctta
ctgttgccagcatttgtcgctgcagcggatattgaagaacgtattacccagcgcctgcaa
accgccgtaccgggcctgcagatagaaagcatggcgccggcaaaagcgccgggcatatac
gaggtgcgcaccaacagcggtcagattgtgtacgccaccgaagatgcggaatatctgttt
attggtgacctggtcaaacttgaaagcgccggctacgttaacctcaccgaacaggcacgt
accagccagcgccggcaaactattaacgagcatgccaaaaatggtggcttgatccagtac
gccgccaaaggtgaacaaaaagcggtgattgacgtgtttaccgacatcgattgcggttac
tgccgcaaattacacggcgaaatggatgaacttaacgaactgggcattaccgtgaattac
ttcggttttccccgttccggtccgggtactgaatccttccgcaagtacgtgtccgtgtgg
tgcgcaaaagacccgcaagcggctatgaacaaggccaaaagcggcggctccgtttcgtcc
gctgactgcgccaacccggtggctgagcaatacaacctaggccgactggttggcgtaacc
ggtacccccgctatcgtattggaagatggaacattaatgccgggctacgtgcctgccaaa
actctggcgcgcagtttgggtattctttaa

DBGET integrated database retrieval system