KEGG   Marinobacter sp. BSs20148: MRBBS_0948Help
Entry
MRBBS_0948        CDS       T02323                                 

Gene name
thrC
Definition
Threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MRBBS_0948 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MRBBS_0948 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MRBBS_0948 (thrC)
Enzymes [BR:mbs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MRBBS_0948 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
995820..997220
Genome map
AA seq 466 aa AA seqDB search
MRYISTRGDSPALGFEDVLLTGLAPDGGLYVPESLPQFNLEEIRSWRGLSYSELAFKVMY
PFVEGAIPADDFRTMLDDTYGVFAHKAIAPLVQIDSNEWVLELFHGPTLAFKDFALQLLG
RLLDYVLERRKQHVVIMGATSGDTGSAAIEGCRRCEHVDIFILHPYQRVSEVQRRQMTTV
QGDNIYNIAVRGNFDDCQRMVKASFGDQSFLGGKTQLAAVNSINWARIMAQIVYYFHASL
ALGGPDRSMAFSVPTGNFGDIFAGYLARKMGLPISQLVIATNRNDILHRFMSGNKYEQQH
LEATLSPSMDIMVSSNFERLLFDLHGRDGHAVKTLLEDAAKGPVSIDDFRWKQARSLFDS
SAIDDKDTCDTIRDVFQQNAYLLDPHTAIGVRAARNCRRDASIPMITLGTAHPAKFPDAI
AASGVSAKPELPAHMVDLFEREEKYTVLDNNIADVQGFIAKHWKNT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtgagatacatcagcacgcggggtgactcgcccgcactgggttttgaagatgttctgctg
accggcctggcgccagacggcggtttgtacgtgcctgaaagcctaccccagttcaatctg
gaagaaattcgcagctggcgtggcctaagctacagcgaactggcgtttaaggtgatgtac
ccgtttgtcgaaggcgccattcccgccgacgatttccgcaccatgctggatgacacctac
ggcgtattcgctcacaaggccattgccccgctggtacagatcgacagcaacgaatgggtg
ttggagctgtttcacgggcccaccctggcgttcaaagactttgcactgcaactgctgggc
cgcctgctggattacgtgctggaacggcgtaagcagcacgtggtgattatgggcgctacc
tctggtgataccggttcggccgccatcgaaggctgccgccgctgcgaacacgtggatatc
tttattctgcacccctaccagcgcgtgtccgaagtacagcgtcggcagatgacgacggtg
caaggcgataatatttacaacattgccgtgcgtggtaattttgatgactgccaacgtatg
gtgaaagccagctttggcgaccagtcgtttctgggtggaaaaacccagctggcggcggtg
aattccatcaactgggcccgcatcatggcccagattgtgtattattttcatgcttctctg
gccctcggtgggccagatcgcagcatggcgttctcggtgcccaccggcaactttggcgat
atctttgccggttacctggcgcggaaaatgggcctacccatttcccagctggtgattgct
accaaccgtaacgacatactgcatcgctttatgagcggcaacaaatacgagcagcaacat
ttggaggctaccctttcgccaagcatggacattatggtgtccagcaacttcgagcgcctg
ctgtttgatctgcacggccgcgacggtcacgccgtgaaaacactgctggaagacgccgcc
aaaggcccggtcagcatcgacgacttccgttggaagcaggcccgcagtctttttgacagc
agtgcgatagacgacaaagacacctgcgacaccatccgcgacgtgttccagcaaaacgca
tacctgttagacccgcacaccgccattggcgtgcgcgccgcccgcaactgccgccgcgat
gccagcattccgatgattaccctgggcaccgcccacccggcgaaatttcccgatgcgata
gccgcatctggcgtgagcgctaagcccgaactgccggcgcacatggtcgatctgttcgag
cgagaagagaaatacaccgtgctggacaacaacatcgccgacgttcagggctttattgcc
aaacattggaaaaacacctga

DBGET integrated database retrieval system