KEGG   Marinobacter sp. BSs20148: MRBBS_1023Help
Entry
MRBBS_1023        CDS       T02323                                 

Gene name
cheB4
Definition
chemotaxis response regulator protein-glutamate methylesterase 4
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MRBBS_1023 (cheB4)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    MRBBS_1023 (cheB4)
Enzymes [BR:mbs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     MRBBS_1023 (cheB4)
Two-component system [BR:mbs02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   MRBBS_1023 (cheB4)
Bacterial motility proteins [BR:mbs02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    MRBBS_1023 (cheB4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1093973..1095112
Genome map
AA seq 379 aa AA seqDB search
MTVSVLIVDDSSFFRKRLSEILGASGQITVVGTASNGREAVEQAEKLRPDVITMDYEMPV
MDGITAVREILRRHPIPVLMFSSLTYDGARVTLDALEAGAVDFLPKNFEEIAGNSSQLQK
ILVERVVSIARSRPKSFGSTRAPEPPEASAGAAADRAATPEVQRRPIAKRPAAAAAVASP
ERHHRRTPSRHYTVVAIGTSTGGPVALQNVLIGLPASFPAPLILVQHMPASFTPAFAERL
NRSCQIQVRQAEDGDLLRPGLALLAPGGKQMMVENRGGQGRIRILPGDDRLNYKPSVDVT
FGSLARSFPGKTLGIVLTGMGADGREGCRMMKQSGSIVWSQDEKSSVIYGMPMAVAKAGL
SDEVLALNDVCQRLKDGVC
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgacggtttctgtgctgattgttgatgattccagtttctttcgtaaacgtctgagtgaa
atcttgggtgcgtctggccagatcaccgtggttggcaccgccagtaacggccgcgaagcg
gtagagcaagcagagaaactgcgccctgatgtgattaccatggattacgaaatgcctgtc
atggacggtattacggccgtgcgggaaatactgcgcagacacccgataccggtgttgatg
ttttcgtcgcttacttatgatggtgcgcgggtcaccctggatgcgctggaagctggagcc
gtggattttctgcccaagaatttcgaggaaattgccggcaacagcagtcagttacaaaaa
atattggtagaacgtgttgttagtatcgcccgtagccggcccaaaagctttgggagcact
cgcgccccggaaccaccagaggcatcggctggggctgcggctgaccgagctgcgactcca
gaggtacagcggcgccccatagctaagcgccccgcggctgcagcagcggttgccagtcca
gagcgccatcaccggcgcacaccatccaggcactacacagtggtggcgatcggcacctct
accggtggcccggtggccctgcagaacgtgctcatcggcctgcccgccagctttcctgca
ccgctgattctggtacagcacatgcccgccagtttcaccccggcttttgccgagcggctg
aaccggtcatgccaaatacaggtgcgccaggccgaagatggtgatttgctgcgccccggc
ctggctttgttggcaccgggcggcaaacagatgatggtggaaaaccgcggcggccagggc
cggatacgaatattgcccggcgatgatcggctcaattacaaaccttcggtagatgtcacc
tttggttcgctggcgcgcagctttcccggtaaaaccttgggtattgtactaacgggcatg
ggcgcagatggccgcgaaggctgccgcatgatgaaacagagcggctcgattgtgtggtcg
caggatgaaaaaagctcggtgatttacggcatgcccatggccgtggctaaggccggcctg
agtgacgaagtcctggcgctgaacgacgtttgccagcggcttaaagatggagtttgctga

DBGET integrated database retrieval system