KEGG   Marinobacter sp. BSs20148: MRBBS_1140Help
Entry
MRBBS_1140        CDS       T02323                                 

Gene name
ycjM
Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MRBBS_1140 (ycjM)
Enzymes [BR:mbs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     MRBBS_1140 (ycjM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1212625..1214355
Genome map
AA seq 576 aa AA seqDB search
MSQVLKSKLVSMLEAVYPALDCDFLAERLLKTMGLRPGQPPPPAHQSHWSESDVVLITYA
DTVQQGEEKPLATLHQFLNRHFADSVSAVHILPFFPYSSDDGFSVMDYLAVNESHGGWED
IEAIAQDFKLMADLVVNHMSARSRWFENFRKRIDPGKDYFFEGNPGDDLSAVVRPRTSPV
LTPVQTDDGERYVWCTFSEDQVDLNFANPQVLIEFATIIRYYLERGVVIFRLDAVAFLWK
EPGTSCIHLQQTHELIRILRLLMEHHSPDAVVITETNVPNRENLTYFGNANEAHAIYNFS
LPPLLINTLVTGDCKHLKTWLMSMPPAQMGTTYLNFIASHDGIGMRPTDGLLTEEERQRF
INTMSSFGGKVSYRRTPDGRDQPYEVNIALYDALKGTAGNGADHWQLQRFMCAHTVMLAL
EGIPAFYIHSLLATENDTARVEHTSRLRSINRSQWQLGDLERELDNPLSHHSKVCHELKR
LIAIRRGQAAFHPNATQFTLHLGLKLFGFWRQSMRRDQSIFCIHNISDEIQQVALSDINL
IGTDYWFDLISGMPIENLSGSITLKPYQSVWLSNRE
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggtgttgaaatccaagctggttagcatgcttgaggctgtttatccggcgctg
gattgtgactttcttgctgagcggctactgaaaacgatggggttgcgtccaggccagcct
ccgccgccggcgcaccagagccactggagtgaatcggatgtggtgcttattacctatgca
gataccgtgcagcagggagaggagaaaccgttagcgaccttgcaccagttcctgaatcga
cactttgctgacagcgtgtccgccgtccatatcctgcccttctttccttacagctccgat
gacggtttctcggtaatggattaccttgcggtcaacgagtcccacggtgggtgggaggac
attgaggccatcgcacaagacttcaaactgatggcagacctggtggtcaaccatatgtca
gcccgcagtcgttggtttgaaaatttccgtaagcgaatagaccctggtaaagactatttt
tttgagggaaaccccggcgacgatttgagcgccgtggtcaggccgcgcacatcaccggta
ctcacgccggttcagacagacgatggtgagcgttatgtgtggtgcacttttagcgaggat
caggtcgaccttaactttgccaacccgcaggttctgattgagtttgcgaccattatccgt
tattaccttgaacgcggcgttgttatctttcggctggacgccgtcgctttcctgtggaaa
gagcccggtacgtcctgcattcacctgcaacagacccacgaactgatcaggattttgcgt
ctgctgatggagcaccatagcccggatgcggtggtgattacggaaaccaatgtgcccaat
cgcgagaatctcacctatttcggcaacgccaacgaagcccatgcaatctataatttttct
ttaccgccgctactgatcaatacgctggtaacaggtgactgcaaacatctgaaaacctgg
ctgatgagcatgccgccggcgcagatgggcaccacctacctcaatttcattgcgtctcac
gacgggattggcatgcgccccacagacggcttgctgaccgaggaggaaaggcaacggttt
atcaataccatgagctcgttcggcgggaaggtgtcttaccggcgcacgcccgacggccgg
gatcagccctacgaagtgaacattgccctgtatgatgcgttaaagggcaccgccgggaac
ggtgcagaccattggcagctacagagatttatgtgtgcgcacacggtgatgctcgctttg
gaggggatacccgctttttacatacacagtttgctggcaacggaaaacgataccgcgcgg
gttgagcataccagccgtttgcgttccatcaatcgcagccagtggcagcttggcgatctg
gaacgggagctggataacccgctgagccaccacagcaaagtctgtcacgaactgaaacgc
ctgattgcgatccgccgtgggcaagcggcgtttcatcccaatgcgacccagtttaccttg
caccttgggctaaagctgttcggcttctggcgccaaagtatgcggcgggatcagtctatt
ttctgcattcacaatatcagtgacgagatacagcaggtggcgcttagtgatatcaacctg
attggcacagattattggtttgacttgatctcgggtatgcccatagagaacctgtcgggc
agtatcacactgaagccctatcagagtgtctggttgtctaatcgcgagtag

DBGET integrated database retrieval system