KEGG   Marinobacter sp. BSs20148: MRBBS_1160Help
Entry
MRBBS_1160        CDS       T02323                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
mbs00900  Terpenoid backbone biosynthesis
mbs01100  Metabolic pathways
mbs01110  Biosynthesis of secondary metabolites
mbs01130  Biosynthesis of antibiotics
Module
mbs_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MRBBS_1160 (dxr)
Enzymes [BR:mbs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     MRBBS_1160 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom
Motif
Other DBs
NCBI-ProteinID: AFP30098
UniProt: M1FHY4
Position
1232589..1233650
Genome map
AA seq 353 aa AA seqDB search
MATLCREFEPAIAVMADGPAAEKLREALSDLPHIRVLTGEAGLSEAATSPEVDTVMAAIV
GAAGLPSTLAAVRAGKRVLLANKEALVMSGRLFMDAVEESGAELLPIDSEHNAIFQCIPA
GRIRQPDAAGITRILLTASGGPFRKMQAADMALVTPDQACAHPNWSMGRKISVDSATLMN
KGLELIEACWLFNISPEKIEVHVHPESIIHSMVEYADGSVLAQLGSPDMRTPIANGLAWP
ERIDAGVAPLDLFAIGRLHFERPDTERFPCLRLAAEAFKTGGTAPAVLNAANEVAVEAFL
QGRVRFTDIPVIIGQTLSAVAAVPADSFDIIFSKDSEARQFAYACVTKLACEK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggctactttgtgccgtgagtttgaaccagccattgcggtaatggctgatgggccggcg
gctgaaaaattacgcgaggccttgtctgatttaccgcatataagagtgctgactggtgaa
gccggtctgagtgaggcggcgactagcccggaagttgacacggtgatggcggccattgtg
ggtgcggctggtttgccgtcaactcttgccgcggtgcgcgctggtaagcgagttttactg
gccaataaagaagcgctagtgatgtctgggcgcttgttcatggacgctgtggaggaatcg
ggcgcggaattgctgcccattgattccgagcacaacgccatatttcagtgcataccggcc
ggccgtattcgccagcccgatgccgcgggcattacccgtattttgctgaccgcctcaggc
gggcctttccgtaaaatgcaagcggcggacatggcattggtaacgcctgatcaggcatgc
gcccaccccaactggtccatgggtcgaaaaatatctgttgattctgccacccttatgaat
aaagggctggagctgatcgaagcctgttggctgttcaatatctcgccggaaaaaattgaa
gtgcacgttcatccggagagtattatccactctatggttgaatacgccgacggctcggtg
ctggcgcagttgggcagtccggacatgcgtacgccgattgctaacggcttggcctggcca
gagcgtatcgatgctggcgtagcaccgctagacctgtttgctattggccgacttcacttt
gagcgccctgataccgagcgttttccgtgtttgcgcctggccgcagaagcctttaaaaca
ggaggtaccgcaccggcagtgctcaatgccgccaacgaggtcgcggtggaagctttttta
cagggcagggttcgctttactgacatccccgttatcataggccaaaccttatccgccgtt
gctgccgttccggccgacagctttgacataattttcagtaaagattctgaagcgcggcag
ttcgcctacgcctgtgtgacaaagctggcgtgcgaaaagtag

DBGET integrated database retrieval system