KEGG   Marinobacter sp. BSs20148: MRBBS_1245Help
Entry
MRBBS_1245        CDS       T02323                                 

Gene name
mauG
Definition
methylamine utilization protein MauG
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mbs  Marinobacter sp. BSs20148
Brite
Enzymes [BR:mbs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     MRBBS_1245 (mauG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1319495..1320286)
Genome map
AA seq 263 aa AA seqDB search
MHDGRLGTNLNDVTREMITESYLMNMDMRLMQERLKQDPVYVSMFKEAYGAEPSNGLVRK
AIPEFLKTLISRNSSFDNGALSSSAKSGFELFKGKAGCAQCHTGPLFSDGKAHNTGVPEN
LDVFLDPGSYQAFLAYNKFMGNENLMNIKRDLGAHVQSHKVDGSDKGKFMTPTLRELTYT
APYMHNGMIKTLPEVIAFYNIGGEADTRKSDLLKPLGLSAKEQNDLVTFLKSLSGDSLDN
TDFVLENKNFSYQPMTNWRKTSN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcacgatggccgcctgggaaccaacctgaacgacgtcacccgagaaatgatcaccgaa
agctatctgatgaatatggatatgaggttgatgcaggagcgcctcaaacaggatcccgtg
tatgtaagcatgtttaaggaggcctacggggccgagccatccaatggactggttcgcaaa
gccataccggaatttttgaagacactgatatcccgaaacagcagtttcgataacggggcg
ctctcgtcttcggcaaaaagtggttttgagcttttcaagggcaaagccggttgtgcgcaa
tgtcataccggtccgctgttctccgacggcaaagcccacaatacaggtgtaccagagaat
ctcgatgtctttctggatccaggcagctaccaagcctttctcgcttataacaagttcatg
gggaatgaaaacctgatgaacatcaaacgggatctgggcgcgcatgttcaatcccacaaa
gtggacggtagtgacaaaggaaagttcatgaccccgaccctccgggaacttacctacaca
gcgccctacatgcataacgggatgatcaaaaccctaccggaggttattgcgttttataac
attgggggcgaagcggatacgcggaagagtgacttgctgaagcctttgggactgtctgct
aaggagcagaacgatcttgtgacttttctgaaatcgctttccggtgactctctggacaac
accgatttcgttctggaaaacaagaacttcagctaccaaccaatgaccaattggcgcaaa
acgtccaattaa

DBGET integrated database retrieval system