KEGG   Marinobacter sp. BSs20148: MRBBS_1313Help
Entry
MRBBS_1313        CDS       T02323                                 

Gene name
mtnB
Definition
methylthioribulose-1-phosphate dehydratase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mbs00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1401389..1402081
Genome map
AA seq 230 aa AA seqDB search
MSDSSATVSEFSKQLIQGIGILERLGVIDFNGHFSVRLPDGRILINSGDSVRSALTLDDF
VTVGADGEMDPEQPRPPAELPLHLSIYQVRPDVKAVVHGHPKWSTLLTSAGEKYQVALAQ
GALLGNVPIYPSPQSVNNKEIGDKVAETLGGGKAALLKAHGSILVAQDVLEATVMAIYLE
LNAERQVLAAPLGGSYIFSPEEVEGSRKGLSKRGLFEKCWNYYIAKFELG
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgattcttcagcgactgtatccgagttcagcaagcagcttatccagggcattggg
atcctggagcgtcttggggttattgattttaacggccacttcagtgtgcgtctgcctgac
gggcgcattctgatcaacagtggtgattccgtccgcagtgcgctgacgctagacgatttt
gtcacggtgggtgcggacggcgagatggatcccgagcagccgcggccacctgctgaactt
cccttgcacctttcgatctaccaggtgcgtccggatgtgaaggccgtggttcatgggcac
ccaaaatggtcaaccttgctgacaagcgccggtgagaagtatcaggtggcattggcccag
ggtgcgcttctgggcaacgtaccgatctatccttccccccaatcagtcaacaataaagaa
attggtgacaaagttgcggaaaccctcggcgggggcaaggctgcgttgctcaaggcgcac
ggctcgattctggtagcccaggatgttctggaggcgaccgtgatggccatttaccttgag
ttgaatgcggagcggcaggtgctcgcggcgcctctgggcggcagttacatcttctccccg
gaggaagtagagggtagccgtaaagggctgtctaagcggggcctgtttgagaaatgctgg
aattattacatcgcaaaatttgagctgggctga

DBGET integrated database retrieval system