KEGG   Marinobacter sp. BSs20148: MRBBS_1313Help
Entry
MRBBS_1313        CDS       T02323                                 

Gene name
mtnB
Definition
methylthioribulose-1-phosphate dehydratase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MRBBS_1313 (mtnB)
Enzymes [BR:mbs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MRBBS_1313 (mtnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1401389..1402081
Genome map
AA seq 230 aa AA seqDB search
MSDSSATVSEFSKQLIQGIGILERLGVIDFNGHFSVRLPDGRILINSGDSVRSALTLDDF
VTVGADGEMDPEQPRPPAELPLHLSIYQVRPDVKAVVHGHPKWSTLLTSAGEKYQVALAQ
GALLGNVPIYPSPQSVNNKEIGDKVAETLGGGKAALLKAHGSILVAQDVLEATVMAIYLE
LNAERQVLAAPLGGSYIFSPEEVEGSRKGLSKRGLFEKCWNYYIAKFELG
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgattcttcagcgactgtatccgagttcagcaagcagcttatccagggcattggg
atcctggagcgtcttggggttattgattttaacggccacttcagtgtgcgtctgcctgac
gggcgcattctgatcaacagtggtgattccgtccgcagtgcgctgacgctagacgatttt
gtcacggtgggtgcggacggcgagatggatcccgagcagccgcggccacctgctgaactt
cccttgcacctttcgatctaccaggtgcgtccggatgtgaaggccgtggttcatgggcac
ccaaaatggtcaaccttgctgacaagcgccggtgagaagtatcaggtggcattggcccag
ggtgcgcttctgggcaacgtaccgatctatccttccccccaatcagtcaacaataaagaa
attggtgacaaagttgcggaaaccctcggcgggggcaaggctgcgttgctcaaggcgcac
ggctcgattctggtagcccaggatgttctggaggcgaccgtgatggccatttaccttgag
ttgaatgcggagcggcaggtgctcgcggcgcctctgggcggcagttacatcttctccccg
gaggaagtagagggtagccgtaaagggctgtctaagcggggcctgtttgagaaatgctgg
aattattacatcgcaaaatttgagctgggctga

DBGET integrated database retrieval system