KEGG   Marinobacter sp. BSs20148: MRBBS_1437Help
Entry
MRBBS_1437        CDS       T02323                                 

Gene name
pcm1
Definition
protein-L-isoaspartate O-methyltransferase 1
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mbs  Marinobacter sp. BSs20148
Brite
Enzymes [BR:mbs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     MRBBS_1437 (pcm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1534967..1535623
Genome map
AA seq 218 aa AA seqDB search
MSAHMQGIGMTSRRTRLRLIQRLKDKGISSPQVLDAIAEVPRHIFLDEALAHRAYEDTAL
PIGHNQTLSQPYIVARMTELLYGHQPKKVLELGTGSGYQTAVLCNLFAEVFSVERIKPLQ
DRARERLRDLKCRNAVLRHADGGMGWPERGPYDGIIVTAAPTEVPTELLQQLADNGVLIS
PVGAERQILVQIVRRGDRFERTELEAVKFVPLLSGVVR
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcacatgcaaggaataggcatgacgtccaggcgcacccgcctgcgcttgatc
cagcgcctgaaagacaaaggcatctcgtcaccacaggtgttagacgccatagccgaggtt
ccacgccatatttttctcgatgaagctttggcgcacagagcctatgaagataccgctttg
ccgattggccacaaccagaccttgtcgcaaccttatattgttgcccgtatgacagaattg
ttatacggccaccaaccgaagaaagtgttggaattgggtaccggctctggctatcagact
gcggtgctgtgcaatttgtttgccgaggtgttcagcgttgaacgcataaaaccacttcag
gaccgagcaagggagcgcttacgcgatctaaagtgtcgcaacgctgtgctgcgccacgct
gatggtggtatgggctggcccgaacgtggcccgtacgacggcattattgtaaccgccgca
cccaccgaggtacccaccgagctgctgcaacagcttgcagacaatggtgttctgatctcc
ccggtgggggctgaacgacagatactggttcaaattgtgcgccgtggcgatcgttttgaa
cgcacggaattggaggcggtcaagtttgtacctttgttgagcggagtggtgcgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system