KEGG   Marinobacter sp. BSs20148: MRBBS_1540Help
Entry
MRBBS_1540        CDS       T02323                                 

Gene name
tesA
Definition
Esterase TesA
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:mbs01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1650709..1651338)
Genome map
AA seq 209 aa AA seqDB search
MFKNTVLPAVRSFALLLVLVMTPGLISANTLLVMGDSLSAAYGVPEETAWVNLLRQRLAD
KGHNDWSVVNASISGETADGGARRLPGLLNKHQPQLVIVELGGNDGLRGFPPQVIEKNLA
LMLKNSQQAGAQTLLVGMQIPPNYGDRYTQAFAAIFGDLAQRFNSALVPFFLDDIYNVDS
LMQSDGIHPTEPAQSILLDNVWPHLVPLL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtgttcaagaatacggttttaccggcggtcagatcatttgcactgctgcttgtgctggtt
atgacgccaggtttgatcagtgccaacaccctgctggtaatgggcgacagcctgagcgcg
gcctatggcgtaccggaagaaaccgcctgggtaaatttgctgcgccaacgcctggccgac
aagggccacaacgactggagcgtggtaaatgccagcatcagcggcgaaacagccgacggc
ggagcccgccggctgccgggtttactgaacaagcaccagccgcaactggtgatcgtggag
ctgggtggcaacgatggcctgcgcggttttccaccgcaggtgatcgaaaaaaacctggct
ttgatgctcaagaacagccaacaggctggcgcccaaaccctactggtgggtatgcaaata
ccacccaattacggcgaccgttacacccaggctttcgccgctattttcggagatcttgca
cagcgcttcaactccgcactggtgcccttcttcctggacgacatttacaacgttgacagc
ttaatgcaaagcgatggcattcaccccacagaaccggcgcaaagcattctgttggacaat
gtgtggccccacctggtgcctttgctttga

DBGET integrated database retrieval system