KEGG   Marinobacter sp. BSs20148: MRBBS_1540Help
Entry
MRBBS_1540        CDS       T02323                                 

Gene name
tesA
Definition
Esterase TesA
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    MRBBS_1540 (tesA)
Enzymes [BR:mbs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MRBBS_1540 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     MRBBS_1540 (tesA)
Lipid biosynthesis proteins [BR:mbs01004]
 Fatty acid synthase
  Component type
   MRBBS_1540 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1650709..1651338)
Genome map
AA seq 209 aa AA seqDB search
MFKNTVLPAVRSFALLLVLVMTPGLISANTLLVMGDSLSAAYGVPEETAWVNLLRQRLAD
KGHNDWSVVNASISGETADGGARRLPGLLNKHQPQLVIVELGGNDGLRGFPPQVIEKNLA
LMLKNSQQAGAQTLLVGMQIPPNYGDRYTQAFAAIFGDLAQRFNSALVPFFLDDIYNVDS
LMQSDGIHPTEPAQSILLDNVWPHLVPLL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtgttcaagaatacggttttaccggcggtcagatcatttgcactgctgcttgtgctggtt
atgacgccaggtttgatcagtgccaacaccctgctggtaatgggcgacagcctgagcgcg
gcctatggcgtaccggaagaaaccgcctgggtaaatttgctgcgccaacgcctggccgac
aagggccacaacgactggagcgtggtaaatgccagcatcagcggcgaaacagccgacggc
ggagcccgccggctgccgggtttactgaacaagcaccagccgcaactggtgatcgtggag
ctgggtggcaacgatggcctgcgcggttttccaccgcaggtgatcgaaaaaaacctggct
ttgatgctcaagaacagccaacaggctggcgcccaaaccctactggtgggtatgcaaata
ccacccaattacggcgaccgttacacccaggctttcgccgctattttcggagatcttgca
cagcgcttcaactccgcactggtgcccttcttcctggacgacatttacaacgttgacagc
ttaatgcaaagcgatggcattcaccccacagaaccggcgcaaagcattctgttggacaat
gtgtggccccacctggtgcctttgctttga

DBGET integrated database retrieval system