KEGG   Marinobacter sp. BSs20148: MRBBS_1705Help
Entry
MRBBS_1705        CDS       T02323                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MRBBS_1705 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MRBBS_1705 (sdhD)
   00650 Butanoate metabolism
    MRBBS_1705 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    MRBBS_1705 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1817939..1818184
Genome map
AA seq 81 aa AA seqDB search
MFIIANPGLGYDAWAGLFSQTWMRIFTLMALFSIGAHAWVGLWTVTTDYMKSALPRFLVQ
AACGLTMFVYVVWGIQILWGF
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
gtgttcattatcgccaatcccggcttgggctacgatgcctgggcaggcctgtttagccag
acttggatgcgtatttttacgctgatggctctgttttcgattggcgcacacgcttgggtt
ggtttgtggacagtaacaactgactatatgaaatcagccctgccgcgttttctggtgcag
gccgcgtgcggtctgaccatgttcgtgtatgtggtttggggtattcagatcctgtggggg
ttttaa

DBGET integrated database retrieval system