KEGG   Marinobacter sp. BSs20148: MRBBS_2071Help
Entry
MRBBS_2071        CDS       T02323                                 

Definition
delta 9 acyl-lipid fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:mbs01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:mbs01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2186095..2187051
Genome map
AA seq 318 aa AA seqDB search
MTPARHWLLNIVRWFDSDAGADNLDSDSRAFNLVRVIPFIALHLSCLLVYFTGTSTFAVM
FALAFFWLRMFAITGFYHRYFAHKTFKTSRKTQFIFGVLGASSAQRGPLWWAAHHRHHHQ
HSDQEQDLHSPQQGGFWWAHAGWFTCDAGFAMNERKVRDWLKFPELRFINRFDALVPAVA
ALIIYGIGEGLAAWAPELGTNGFQLLVWGFFVSTVVLFHATVSINSLSHVWGKRRFETGD
DSRNNFWLALLTLGEGWHNNHHRWPQSVRQGFRWYEIDITWYGLWLLARLGIIWDLNPIP
KSVQEETRKLDSIRRMQS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccccagctcgacattggctcttaaatatcgttcgatggtttgattccgacgcaggc
gcggacaacctcgacagtgattcacgggcgttcaacctagtccgcgttataccatttatt
gccctgcatctgtcatgtctgctggtatattttaccggcaccagcacctttgcggtgatg
ttcgcactggcatttttctggctccgaatgtttgcaattaccggattttatcaccgctat
tttgcccacaagacattcaagacaagtaggaaaacccaatttattttcggagtcttggga
gctagttcggcgcagcgcgggcccctttggtgggcggcacaccatcgccatcaccaccag
cattcagaccaagagcaagacttgcactcgccccagcagggcggtttttggtgggcacac
gcgggatggttcacgtgtgacgctggttttgccatgaacgaacgtaaagtacgcgattgg
ttaaaattccccgagttgcgctttattaatcggttcgacgccctggtacctgccgtcgcg
gcactgataatttacggcataggtgaaggcttggcagcttgggcgcccgagctgggaacg
aatggctttcagttattagtatggggctttttcgtctcaactgtggtgctgtttcacgct
actgtgtccatcaactcgctgtcgcatgtgtggggtaagcggcgttttgaaaccggagac
gacagccgcaataacttctggctggcgttgcttactttgggtgagggttggcataacaac
caccatcgctggccgcagtctgtacgccaaggttttcgttggtacgaaatcgacattacc
tggtatggcctatggttactggcccgattgggtattatttgggatctgaacccaattccg
aaaagcgttcaggaagaaactcgcaagttagattccattaggagaatgcagtcatga

DBGET integrated database retrieval system