KEGG   Marinobacter sp. BSs20148: MRBBS_2231Help
Entry
MRBBS_2231        CDS       T02323                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MRBBS_2231 (galU)
   00052 Galactose metabolism
    MRBBS_2231 (galU)
   00500 Starch and sucrose metabolism
    MRBBS_2231 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    MRBBS_2231 (galU)
Enzymes [BR:mbs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MRBBS_2231 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2373994..2374830
Genome map
AA seq 278 aa AA seqDB search
MIKKCLFPVAGYGTRFLPATKAMPKEILPIVNKPLVQYGVEEASDAGIHEFGFVTGRGKR
AIEDHFDISYELEHQIAGSGKEGMLTSIRNLIDNNTFAFTRQSEMKGLGHAILTGRNLVG
DNPFAVVLADDFCVGPDGEDGVLAQMVKLYNQFRCSIVAIEEVPADETHKYGVIAGECMK
DGLFRVTDMVEKPAPEDAPSNMAIIGRYILTPDIFDILERTPPGKNGEIQITDALLEQAK
TGCVLAYQFKGRRFDCGSIDGFVEATNYVYENIYKKGL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaagtgcctgtttcccgttgccggttatggcacccgctttttaccggccacc
aaggccatgcccaaggaaattctgcccatcgtcaacaagccattggttcagtacggtgtt
gaagaggcatcagatgccggcattcacgaattcgggtttgttaccggtcgcggcaagcgc
gccattgaagatcattttgacatcagctacgagcttgagcaccaaattgcgggttctggc
aaagagggtatgctgacctctatccgcaatttgattgacaacaataccttcgcctttacc
cgccagagcgaaatgaagggtctgggccatgcgattctgaccggtcgcaacctggtgggc
gacaaccctttcgccgtggtgctggccgacgacttctgcgtgggccctgacggcgaagac
ggcgtgttggcgcaaatggtcaaactttacaaccagttccgctgttctattgtggccatt
gaagaagtaccggccgacgaaacccacaagtacggtgtaattgctggcgagtgcatgaaa
gacggcttgttccgggtaacggacatggtggaaaagcctgcaccagaagacgcacccagc
aacatggccatcatcggtcgctatattctgacaccggatattttcgacattctggagcgc
acgccgcctggaaagaacggtgaaatacaaattactgacgccctgttggaacaagccaaa
actggctgcgtactggcctaccaattcaaaggcaggcgttttgactgcggcagtatagac
ggctttgtagaagcgaccaattatgtttacgaaaacatctataaaaaaggcttatag

DBGET integrated database retrieval system