KEGG   Marinobacter sp. BSs20148: MRBBS_2443Help
Entry
MRBBS_2443        CDS       T02323                                 

Gene name
glcB
Definition
Malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mbs01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mbs00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mbs00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2582737..2584917)
Genome map
AA seq 726 aa AA seqDB search
MTSRVQLDGLQVAGNLYDFINSEAIPGTGLDADKFWADFAKIVNDLAPRNRELLAKRDSL
QEKLDAWNHNHQHQTPDMHVYKDFLKEIGYLVDEPANFSISTVNVDPEVAVMAGPQLVVP
IMNARFALNAVNSRWGSLYDALYGTDAIPETGGAEKTAGYNPKRGELVIEFARDLLDSSA
PLASGSHKDAALYHVAGGKLVVDLQNGDSIGLKDETGFVGYTGSADAPTGILLVKNGMHF
EIQIDATHPIGKTDGAHVKDVLMESALTTIMDCEDSVAAVDADDKVLAYRNWLGLMNGSL
EETFDKGGKPLTRKMNADRVYTAADGSELQLKGRSVMFIRNVGHLMTNPAILLADGSEVP
EGLLDGVMTSLMAMHDLKGNSRFQNSAQGSMYIVKPKMHGPEEVAFTNEFFGRVEDVLGL
PRFTLKVGIMDEERRTTVNLKACIHAAKDRVAFINTGFLDRTGDEIHTSMKLAPFIRKGK
MKQATWIGAYEQSNVDIGLETGFRGVAQIGKGMWAMPDLMADMLEQKIGHLKAGANTAWV
PSPTAATLHATHYHQVSVADIQQMLESRKRASVDDILTVPINLNSKDLTAAEIQEELDNN
AQSILGYVVRWIDSGVGCSKVPDINNVGLMEDRATLRISSQLLANWLYHGICNKHQIEET
MKRMALIVDKQNAGDASYRPMADNFTDSIAFQAAMDLVLKGAEQPNGYTEPLLHAYRLKA
KAKYGQ
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgacatcacgcgtacagcttgacggtcttcaggttgccgggaatttatacgacttcatc
aacagcgaagcgattcctggaacgggtctggacgcagacaaattctgggcagatttcgcc
aaaatcgtcaacgatcttgcgcctcgcaatcgtgagctgctagccaaacgcgattccctg
caggaaaaactggacgcctggaaccataatcaccagcaccagactccggatatgcacgtc
tataaagatttcttgaaagaaatcggctatttggtcgacgagcccgctaatttcagcatt
tccactgttaacgtagaccctgaagtagccgtcatggcggggccacagcttgttgtgcca
atcatgaacgcgcgctttgccctgaacgcagtcaacagccgttggggcagtttgtacgat
gcgctttacggcaccgacgcgatccctgaaacaggcggcgccgaaaagactgcaggctac
aatccgaagcgcggcgagctcgtgatcgagtttgcccgtgaccttctggacagttcggca
cctttagcctccggcagtcacaaagacgcagcgctctatcatgttgccggtggcaaactg
gttgtggacctgcaaaacggtgacagcatcggtttgaaagatgaaaccggttttgtgggt
tacaccggttcggcagacgctcctacgggcattctgctggttaagaacggcatgcacttt
gaaatccagattgacgccacccatcccattggcaaaaccgatggtgctcacgttaaagac
gtgttgatggaatcggcgctgaccaccattatggattgcgaagactcggtagccgcagta
gatgcagacgacaaagtcctggcttaccgcaactggctgggcctgatgaatggcagcttg
gaagagacctttgataaaggtggtaagccgttaacccgcaagatgaacgcggatcgcgtt
tacaccgccgccgacggtagcgagctgcaactgaagggccgcagcgtgatgttcatccgt
aatgtgggccacctgatgaccaacccggcgattctgctggcagatggcagcgaagtgccg
gaaggcctgctggatggagtgatgacatcgctgatggccatgcacgacctgaaaggcaac
agccggtttcagaatagcgcccaaggctcgatgtatattgttaagccgaagatgcacggc
ccggaagaagttgcgtttaccaacgagtttttcggtcgggtggaagatgttttgggcttg
ccgcgctttaccttgaaagtggggattatggatgaagaacgccgcacaacggtgaacttg
aaggcctgcattcacgccgcgaaagatcgcgtggcgtttattaacaccggctttttggat
cgcaccggtgacgaaattcacacctccatgaagcttgcgccatttatccgcaaagggaaa
atgaagcaggccacgtggattggcgcttacgaacagtcgaacgtagacatcggtctggaa
accgggtttcgcggtgtggcgcaaattggcaagggcatgtgggccatgccggatttgatg
gccgatatgctggaacagaaaatcgggcatctaaaagccggtgccaacaccgcttgggtt
ccatcaccgaccgctgccaccctgcacgccacgcattatcatcaggtgagtgtggctgat
atccagcagatgctggaaagccgcaagcgtgcaagtgtggatgatattcttacggtgccc
atcaatctgaattcaaaagatctgaccgctgcggaaattcaagaggaattggataacaac
gcccaaagtattttgggctacgtggtgcgctggatcgacagcggcgtaggttgctccaaa
gtgcctgacatcaataacgtgggcctgatggaagaccgcgccaccctgcgaatttcgtcg
cagctgctggcgaactggctgtatcacggtatctgcaacaagcaccagattgaagagacc
atgaagcgcatggcactgatcgtggacaagcagaacgccggtgacgcaagttatcgccca
atggccgataactttaccgacagcattgcgtttcaggcggctatggatttggttctgaaa
ggcgccgagcagcctaatggctacacagaaccgttactgcacgcataccggttgaaagca
aaagcgaaatacggacaataa

DBGET integrated database retrieval system