KEGG   Marinobacter sp. BSs20148: MRBBS_2513Help
Entry
MRBBS_2513        CDS       T02323                                 

Gene name
rmlC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    MRBBS_2513 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MRBBS_2513 (rmlC)
Enzymes [BR:mbs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     MRBBS_2513 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2660295..2660840)
Genome map
AA seq 181 aa AA seqDB search
MKITETRIPDVKLIEPNVFGDDRGFFMETWNEKAFREAGIDASFVQDNHSRSVKNTLRGL
HYQIKHPQGKLVRVTRGEVFDVAVDLRTASPTFGQWVGEYLSEENNRMLWVPPGFAHGFL
VTSEMADFQYKCTDFYAPEYERSIHWADLSLGITWPLGTTEEPLVSGKDSAGTPFSSADY
Y
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaccgaaaccagaattcctgacgttaaactcatcgaacctaacgtattcgga
gatgaccgcggctttttcatggaaacctggaacgaaaaggccttccgggaagcgggcatt
gacgcctcctttgtgcaggataaccacagccgctcggtaaaaaacaccctgcgcgggctg
cactaccagatcaaacatcctcaggggaaactggtaagggtaacccgcggcgaagtgttt
gatgtagccgtagacctgcgtacagcctcacccacctttggtcagtgggtaggagagtat
ctctcggaagaaaacaaccgcatgctgtgggtgccgccggggttcgctcacgggtttctg
gtgaccagtgaaatggcagattttcaatacaagtgcacggatttctatgcgccggagtat
gagagatcaattcattgggccgatttatcgttgggtatcacatggcctctgggaacaacg
gaagaaccgctcgtttctggaaaagacagtgcaggcacaccattttcatctgctgattac
tactga

DBGET integrated database retrieval system