KEGG   Marinobacter sp. BSs20148: MRBBS_2795Help
Entry
MRBBS_2795        CDS       T02323                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
mbs00260  Glycine, serine and threonine metabolism
mbs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mbs01100  Metabolic pathways
mbs01110  Biosynthesis of secondary metabolites
mbs01130  Biosynthesis of antibiotics
mbs01230  Biosynthesis of amino acids
Module
mbs_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MRBBS_2795 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MRBBS_2795 (trpA)
Enzymes [BR:mbs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MRBBS_2795 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: AFP31731
UniProt: M1F9E9
Position
complement(2963140..2963970)
Genome map
AA seq 276 aa AA seqDB search
MSVSRIDRCFEALRQQDRAALVTFVTAGYPDYQHSAEILKGLPEAGADIIELGMPFTDPM
ADGVPIQLASQRALAGGHNTIKTLQMVREFREHNQHTPIVLMGYYNPIYCYGVERFLNDA
AASGVDGMIVVDLPPEHDDELCVPAREAGIHFIRLATPTTDAARLPGVLVNTSGFLYYVS
STGVTGSVAPTAEKVEKELARIRQHTNLPVAVGFGIRTAPQAERIARFADAVVVGSALVE
CIANADTEAQGRDDVLSLTRELSAAVREARTTLNVS
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtaagtcgtattgatcgttgttttgaagccttgcgccagcaagatcgtgctgcc
ctggttacgtttgtaaccgcaggctatccggactatcagcacagcgcggagattttaaaa
gggttgcctgaagccggtgccgatatcatcgaactgggaatgccattcaccgaccctatg
gccgatggtgtgcccattcagcttgctagccagcgcgctttggccggtggtcacaacacc
atcaaaaccctgcagatggtgcgtgaattccgcgagcataatcagcacaccccgattgta
ctgatgggctattacaacccaatttactgctacggtgtagagcgttttctgaatgatgcc
gcagcgtccggtgtagacggtatgatcgtggtggatttgccgccagagcatgacgacgaa
ctgtgcgtgccggcccgcgaagctggtattcactttattcgtctggcaacgccgaccacc
gatgctgcccggctgcctggtgtgctggtaaatacttccggctttttgtactacgtttcc
agcacaggtgttactggctctgtggcacctaccgctgaaaaagtggaaaaagaactggcg
cggattcgacagcatacaaacttgccggtggccgtgggcttcggtattcgtaccgcaccc
caagctgagcgtattgcgcgttttgccgatgccgtagtggtgggttcggctttggtggaa
tgcatagccaatgcagataccgaagcgcagggtcgcgatgatgtgttgtcgcttacgcgg
gaactttcggctgcggttagagaggcgcggacgacattgaacgtttcctga

DBGET integrated database retrieval system