KEGG   Marinobacter sp. BSs20148: MRBBS_2796Help
Entry
MRBBS_2796        CDS       T02323                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MRBBS_2796 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MRBBS_2796 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MRBBS_2796 (trpB)
Enzymes [BR:mbs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MRBBS_2796 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2963972..2965225)
Genome map
AA seq 417 aa AA seqDB search
MSTATTLRQGPDINGFFGHFGGRFVAETLMPLVLELQEEYARARNSKEFIDEMDALRRDF
VGRKSPLYLAERLTEQLGGAKVYLKREDLLHTGAHKINNCLGQILLAKRMGKTRIIAETG
AGMHGVATATVAARFGMECVVYMGSVDIHRQQPNVQRMRLLGAKVIPVTSGAGTLKDAMN
DALRDWVTNVADTFYIIGTVAGPHPYPAMVRDFQSIIGEETREQIIEREGRLPDTLVACV
GGGSNALGLFHPFLDDKSVAMVGVEAAGEGLDKRHAASLKGGTPGILHGNRTFLLQSADG
QIQDAHSISAGLDYPGIGPEHAWLNEIGRVSYAAITDDEALEAFHTLCRIEGIIPALETA
HAIAYVMKVAPTLPQDHLIVINLSGRGDKDMSTVLAAMDASAENAEKNAGKAVKGEA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagcaaccacgctacgacagggcccggacattaacggttttttcggtcatttt
ggtggccgttttgtggccgagaccttgatgccgctcgttcttgaactgcaagaagaatat
gcaagggcgcgcaattcaaaagaatttattgatgagatggacgctttgcgacgtgacttt
gtcggccgcaaaagcccgctgtatctggctgaacggttaactgaacagctcggcggggcc
aaggtatacctcaagcgggaagatcttttgcacaccggcgctcacaagatcaacaattgc
ctaggccagattttgttggccaaacgcatgggtaaaacccgtatcatcgcggaaaccggg
gcgggcatgcacggtgtggcaaccgccaccgtagctgcgcgctttggtatggaatgcgtg
gtgtacatgggcagcgtcgacattcaccgtcagcagcccaacgtgcagcgcatgcgtttg
ctgggcgccaaagtaatcccggtcaccagcggtgcaggcactctgaaagacgctatgaat
gatgccctgcgtgactgggttaccaacgtggccgatactttttatatcatcggcacagta
gcaggcccgcacccctatccggctatggtgcgtgatttccaatcgattattggtgaagaa
acccgcgagcagattatcgagcgtgaggggcgcctgcccgacacgttggtagcctgcgtc
ggtggcggctcaaacgccttgggtctgttccatccgtttttggatgataagagcgtcgct
atggtgggtgttgaggccgccggtgaaggcttggacaagcgtcacgcggccagcctgaaa
ggcggcaccccgggcatattgcacggcaaccgtaccttcctgcttcaatccgctgacggt
cagattcaggatgcccattcgatttcggcgggtctggattacccgggcattggcccagaa
cacgcctggttaaacgagattggccgggtcagctacgccgccattactgatgacgaagct
ctcgaagccttccacacgttgtgccgcattgaaggtattattccggcgctggaaacagcc
catgctattgcttacgtgatgaaagtggctccgacattgccgcaggaccacttgattgtt
atcaacctgagcggccgcggtgataaagacatgtcgaccgtccttgccgcgatggacgcc
agtgcggaaaacgccgaaaaaaacgctggtaaagccgttaaaggggaagcctga

DBGET integrated database retrieval system