KEGG   Marinobacter sp. BSs20148: MRBBS_2796Help
Entry
MRBBS_2796        CDS       T02323                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
mbs00260  Glycine, serine and threonine metabolism
mbs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mbs01100  Metabolic pathways
mbs01110  Biosynthesis of secondary metabolites
mbs01130  Biosynthesis of antibiotics
mbs01230  Biosynthesis of amino acids
Module
mbs_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MRBBS_2796 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MRBBS_2796 (trpB)
Enzymes [BR:mbs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MRBBS_2796 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFP31732
UniProt: M1FHC7
Position
complement(2963972..2965225)
Genome map
AA seq 417 aa AA seqDB search
MSTATTLRQGPDINGFFGHFGGRFVAETLMPLVLELQEEYARARNSKEFIDEMDALRRDF
VGRKSPLYLAERLTEQLGGAKVYLKREDLLHTGAHKINNCLGQILLAKRMGKTRIIAETG
AGMHGVATATVAARFGMECVVYMGSVDIHRQQPNVQRMRLLGAKVIPVTSGAGTLKDAMN
DALRDWVTNVADTFYIIGTVAGPHPYPAMVRDFQSIIGEETREQIIEREGRLPDTLVACV
GGGSNALGLFHPFLDDKSVAMVGVEAAGEGLDKRHAASLKGGTPGILHGNRTFLLQSADG
QIQDAHSISAGLDYPGIGPEHAWLNEIGRVSYAAITDDEALEAFHTLCRIEGIIPALETA
HAIAYVMKVAPTLPQDHLIVINLSGRGDKDMSTVLAAMDASAENAEKNAGKAVKGEA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagcaaccacgctacgacagggcccggacattaacggttttttcggtcatttt
ggtggccgttttgtggccgagaccttgatgccgctcgttcttgaactgcaagaagaatat
gcaagggcgcgcaattcaaaagaatttattgatgagatggacgctttgcgacgtgacttt
gtcggccgcaaaagcccgctgtatctggctgaacggttaactgaacagctcggcggggcc
aaggtatacctcaagcgggaagatcttttgcacaccggcgctcacaagatcaacaattgc
ctaggccagattttgttggccaaacgcatgggtaaaacccgtatcatcgcggaaaccggg
gcgggcatgcacggtgtggcaaccgccaccgtagctgcgcgctttggtatggaatgcgtg
gtgtacatgggcagcgtcgacattcaccgtcagcagcccaacgtgcagcgcatgcgtttg
ctgggcgccaaagtaatcccggtcaccagcggtgcaggcactctgaaagacgctatgaat
gatgccctgcgtgactgggttaccaacgtggccgatactttttatatcatcggcacagta
gcaggcccgcacccctatccggctatggtgcgtgatttccaatcgattattggtgaagaa
acccgcgagcagattatcgagcgtgaggggcgcctgcccgacacgttggtagcctgcgtc
ggtggcggctcaaacgccttgggtctgttccatccgtttttggatgataagagcgtcgct
atggtgggtgttgaggccgccggtgaaggcttggacaagcgtcacgcggccagcctgaaa
ggcggcaccccgggcatattgcacggcaaccgtaccttcctgcttcaatccgctgacggt
cagattcaggatgcccattcgatttcggcgggtctggattacccgggcattggcccagaa
cacgcctggttaaacgagattggccgggtcagctacgccgccattactgatgacgaagct
ctcgaagccttccacacgttgtgccgcattgaaggtattattccggcgctggaaacagcc
catgctattgcttacgtgatgaaagtggctccgacattgccgcaggaccacttgattgtt
atcaacctgagcggccgcggtgataaagacatgtcgaccgtccttgccgcgatggacgcc
agtgcggaaaacgccgaaaaaaacgctggtaaagccgttaaaggggaagcctga

DBGET integrated database retrieval system