KEGG   Marinobacter sp. BSs20148: MRBBS_3082Help
Entry
MRBBS_3082        CDS       T02323                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MRBBS_3082
Enzymes [BR:mbs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MRBBS_3082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3224201..3224869
Genome map
AA seq 222 aa AA seqDB search
MITVHHLNNSRSQRILWMLEELGVPYEIQHYKRDPKSMLAPDSLKKIHPLGKSPVITDGD
LVIAESGAIIEYLARTYGKGTMLPKSGGQAWLDYTYWLHYAEGSLMPPLLMRLVFEKVKT
SPMPFFVKPVAKGIANKTNEVFIGPMIKMHLDFVESHLAKNTWFLGDNLSAADIQMSFPL
EASVARSITGKNRPSIIAWVKRVHARPAYQIALEKGGEYDFA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgattacagtccaccacctcaataactcccgctcacaacgtattctctggatgttggaa
gagctgggagtgccctacgagatccagcactacaagcgtgatcccaaatccatgctagcg
cctgacagcctcaaaaaaatacacccgctgggtaaatcaccggtgatcaccgacggcgac
ttggttatcgcggagtctggcgccattatcgaataccttgcccgcacctatggcaaaggc
accatgctgccgaagagcggcggccaggcttggcttgattacacatactggctgcattac
gccgaaggctctttaatgccgccgctgctgatgcgcctggtgtttgaaaaggtaaaaacc
agcccgatgccgttttttgtcaagccggtggcaaaaggcattgcgaataaaaccaatgag
gttttcatcggcccgatgatcaaaatgcacctggactttgttgaatctcacctagccaag
aacacctggtttcttggggataacctgagcgctgcggatattcaaatgagctttccgctg
gaagcctcagtggccaggagcattaccggcaagaaccggcctagtatcatagcctgggtg
aaacgcgtgcacgccagaccggcttaccaaatcgcccttgaaaaaggcggggaatacgat
tttgcctga

DBGET integrated database retrieval system