KEGG   Marinobacter sp. BSs20148: MRBBS_3129Help
Entry
MRBBS_3129        CDS       T02323                                 

Gene name
nosZ
Definition
(GenBank) Nitrous-oxide reductase
  KO
K00376  nitrous-oxide reductase [EC:1.7.2.4]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
mbs00910  Nitrogen metabolism
mbs01120  Microbial metabolism in diverse environments
Module
mbs_M00529  Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    MRBBS_3129 (nosZ)
Enzymes [BR:mbs01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     MRBBS_3129 (nosZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COX2 Cupredoxin_1 Cu-oxidase_3 UCR_Fe-S_N TAT_signal
Motif
Other DBs
NCBI-ProteinID: AFP32065
UniProt: M1FFR3
Position
complement(3276482..3278380)
Genome map
AA seq 632 aa AA seqDB search
MSKDHEQDHKELAQTEHLGLSRRRFLGATAAAGVAGVAGLGGAVMSREAFAAAAKEARNN
IHVGPGELDEYYGFWSGGHQGEVRVMGIPSMRELMRIPVFNVDSATGWGLTNESKDVLGH
DNTFLNGDCHHPHISMTDGRYDGKYLFINDKANTRVARIRLDIMKCDKITHIPNVQAIHG
LRLQKVPYTKYVFCNAEYVIPHPNDGNDFSMENSYTMFNALDAETMEVAWQVIVDGNLDN
TDADYTGKYAASTCYNSEKAKDLAGTMRNDRDWVVVFNVERIEQAVKNGDFKTLGDSKVP
VVDGRSKSPLTRYIPVPKNPHGVNTSPDGKYFIAAGKLSPTCSVIAIDKLDDVFDDKIEL
RDVIVAEPELGLGPLHTTYDGRGNAYTTLFIDSQIVKWNIADAIKHYNGEDVNYLRQKLD
VHYQPGHNHASLTESRDADGKWLVVLSKFSKDRFLPVGPLHPENDQLIDISGDEMKLVHD
GPAFAEPHDCIMVRRDQIKTKKIYTRDDPYFASARAQAEKDGITLEGDNKIIRDGKKVRV
YMTSVAPIYGTTEFTVKQGDEVTVYVTNLDTIEDVTHGFSVVNHGVSMEISPQQTSSVTF
VADKPGVHWYYCNWFCHALHMEMTGRMLVEKA
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagatcatgagcaagatcataaagaactggcgcaaacggaacacctcggcctg
agtcgccggcgttttctgggtgccaccgcggcggccggtgtggccggtgttgccggcctt
ggcggcgcagtcatgagccgcgaagcgtttgcagccgccgccaaagaagcacgtaacaac
attcacgtgggcccgggcgagctggacgagtactacggtttctggagcggtggtcaccag
ggcgaagtacgggtaatgggtataccgtctatgcgcgagttgatgcgtattccggtgttc
aacgtggattcagcaaccggttggggcctgaccaacgaaagcaaagacgtactcggccac
gacaacacgtttttgaacggcgactgtcaccacccgcacatctccatgaccgacggccgt
tacgatggcaagtatctgttcatcaacgacaaagccaacacccgtgtggcccgtatccgt
ctggacatcatgaagtgcgacaagattacccacattccgaacgtgcaggccattcacggt
ttgcgcttgcagaaagtgccttacacaaaatacgtgttctgcaacgcagaatatgtgatt
ccacacccgaacgatggcaacgatttctcgatggagaacagctacaccatgtttaacgcc
ctggatgcggaaaccatggaagtggcctggcaggtgattgtcgacggcaacctcgacaac
accgacgccgattacaccggtaaatacgcggcttctacctgctacaactccgagaaagcg
aaagatcttgccggcaccatgcgcaacgaccgcgactgggtggtggtgtttaacgttgag
cgcatcgagcaagcggttaaaaacggcgacttcaaaaccctgggcgattccaaagtgccc
gtggtggatggccgcagcaaatccccgttgacccgctacattccagtgccgaagaatccg
cacggcgtgaacacgtcaccggatggcaagtacttcattgctgctggcaagctgtcgcca
acctgttcggtaattgctatcgacaaactggacgatgtgtttgacgacaaaatcgagctg
cgtgacgtgattgtcgctgaaccggagctgggccttgggccccttcataccacgtatgat
ggccgcggtaacgcctacaccacgctgttcatcgacagccagattgtgaagtggaacatt
gcagacgccataaagcattacaacggtgaagacgtaaactacctgcgccagaagctggat
gtgcactaccagccgggccacaaccacgcgtcgttgacggaatcccgcgatgccgatggt
aagtggctggtggtgttatccaaattctcgaaagaccgtttcctgccggttgggcctttg
cacccggagaacgatcagctgatcgatatttctggcgatgaaatgaagctggtgcacgat
ggcccggccttcgccgaaccacacgattgcattatggtgcgtcgtgatcagatcaaaacc
aagaaaatctatacccgtgacgatccgtacttcgccagtgcccgcgcccaggccgagaaa
gacggtatcacgctggaaggcgataacaagatcatccgcgacggcaaaaaagtgcgcgtt
tatatgacgtcggtggcgcctatttacggtacaaccgagttcaccgtaaagcagggtgac
gaggtgacggtgtatgtgaccaacctggacactattgaagacgttactcacggcttttcg
gtggtgaaccacggtgtgagcatggaaatcagcccgcagcagacgtcgtcagtgaccttc
gtggctgataagccaggtgtgcattggtactactgcaactggttctgtcacgctctgcat
atggagatgacggggcggatgttggtcgaaaaggcctga

DBGET integrated database retrieval system