KEGG   Marinobacter sp. BSs20148: MRBBS_3293Help
Entry
MRBBS_3293        CDS       T02323                                 

Gene name
paaF
Definition
(RefSeq) enoyl-CoA hydratase paaF
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MRBBS_3293 (paaF)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MRBBS_3293 (paaF)
   00650 Butanoate metabolism
    MRBBS_3293 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    MRBBS_3293 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MRBBS_3293 (paaF)
   00310 Lysine degradation
    MRBBS_3293 (paaF)
   00360 Phenylalanine metabolism
    MRBBS_3293 (paaF)
   00380 Tryptophan metabolism
    MRBBS_3293 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MRBBS_3293 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MRBBS_3293 (paaF)
   00281 Geraniol degradation
    MRBBS_3293 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MRBBS_3293 (paaF)
   00627 Aminobenzoate degradation
    MRBBS_3293 (paaF)
   00930 Caprolactam degradation
    MRBBS_3293 (paaF)
Enzymes [BR:mbs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MRBBS_3293 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3449571..3450344
Genome map
AA seq 257 aa AA seqDB search
MPQILLSEGPNNGVRLLTLNRPEALNALNTALLEALSEQLDIAETDPETRALVITGSERA
FAAGADINEMASRDVVGMLEDPRVQHWARIDRFVKPLIIAVNGFCLGGGCELAMRGDILI
AGTNAQFGQPEINLGIMPGAGGTQRLVRAVGQSLAMQMVLTGEAISAQRALAAGLITEIC
QPELTIERAMAIATTIASKGPLAVQLARESVRRGADMDLAAGLRFERHAFTILAATEDRR
EGLNAFRNKRKPQFIGR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagatactgctatcagaagggccaaacaatggcgttcgccttctaacgcttaat
cgtcccgaagccctcaacgctctcaacaccgcgctgcttgaggcgctgagcgagcaactc
gatattgcagaaaccgatcctgaaaccagagcacttgttattaccggcagtgagcgcgcg
tttgccgccggtgccgatatcaacgagatggcctcccgcgatgtcgttggcatgctggaa
gatcctcgtgtccaacactgggcacgcatagaccgctttgttaaaccgctgattatcgcc
gtgaacgggttctgcctgggcggcggctgtgaactcgcaatgcgcggtgacattctcatt
gccggcaccaacgcccagtttggccaacctgaaatcaacctcggcattatgcccggcgcc
ggcgggacccagcgcctggtgcgagcggtggggcaatcactggcgatgcagatggttctc
accggggaagctatcagcgcccaaagagccctcgcagccggtttaatcaccgaaatctgc
caaccggaacttacgattgaacgcgccatggcgatcgccaccacgattgcctccaaaggc
cctcttgcggtgcagctggcgcgtgagtcggtgcgccggggtgcggatatggaccttgct
gccggcctgcgatttgagcgtcacgcgtttaccattctggccgcaacagaagatcgccgc
gaaggtctgaatgcgtttcgcaacaagcgcaaaccccagtttatcggacgctga

DBGET integrated database retrieval system