KEGG   Marinobacter sp. BSs20148: MRBBS_3316Help
Entry
MRBBS_3316        CDS       T02323                                 

Gene name
aceF
Definition
dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:mbs01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mbs00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mbs00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mbs00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3473706..3475391)
Genome map
AA seq 561 aa AA seqDB search
MSEQEIRVPDLGGADEVEVIEILVSAGDSVVEEDPILTVETDKASVELPSPGAGKIVKIT
VKVGDKVKEGDVVGILSSDGASSDGASGDNSAPEPELRAKDDAPAKSDDSASKPAPRKKS
GGTRTETVKVSGLDGFDNIPIIELNVSEGDDVDVESALVTVESDKATMEIPSPLAGKIGK
ILVKEGDKISEGDDLLEMIITDDGSDDGDDADDSAPADSSDVGKKPPAEPKQPAAASDTE
AKPADTGSVTYEAPAAGSKVHAGPAVRKLARELGADLARVKGSGPKSRIVKDDVHGYVKA
QLQQAQQGAVVPGAGSSGIPGVKLPDFSQFGEVEREGMSRMMSVTALNMHRSWLNVPHVT
QFEDADISDMEDFRKSLKPLGEKKGVKMTPLPFMLKACAAALAELPQFNVALDMDRKEVV
HKKYIHIGIAVDTPHGLMVPVIRNVDQKGLWELAAESAELAQKARDKKLKPAEMQGACFT
ITSLGGIGGTAFTPIVNTPEVAILGVSKAAMKPVWDGKVFQPRLMLPLSLSYDHRAVNGA
DAARFTSALARLMGDIRTLLL
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcaagaaatcagggtccccgatctaggtggggcagatgaagttgaagtgatt
gaaatactggtcagcgccggtgattcggtggtcgaagaagatccgattctgacggttgaa
accgacaaggcatcggtagagttgccgtcaccgggcgcgggtaagatcgtaaagatcact
gttaaagtgggtgacaaggtcaaagagggcgacgttgtcggtattcttagttctgatggt
gcaagttctgatggcgcttcaggtgacaacagcgcaccagagcctgaactcagagccaaa
gatgacgcaccggctaagtctgacgacagcgccagcaagccagcgccgcggaaaaaatcc
ggcggcacgcgcacagaaaccgtgaaagtgtctggcctcgatggttttgataacattccg
atcatcgagcttaacgtgtctgaaggcgacgacgttgacgtcgaaagtgcgctggttacc
gtggagtccgacaaggcgaccatggaaattccatcgcccttagccggcaaaattggcaag
attctggttaaagaaggcgacaagatttccgaaggcgacgacctgctggaaatgatcatc
actgacgatggctcagacgacggcgacgacgccgacgactcagccccagctgatagcagc
gatgttggcaaaaagccgccagccgagcctaagcagccggctgcggctagcgataccgaa
gccaaacctgcggataccggttcggtgacctatgaggcgcccgccgctggcagcaaagtg
cacgccggccctgcggttcgcaagctggcccgtgaactgggtgcagacctggcccgggtg
aaaggctccggcccgaaaagccgtattgttaaagacgacgtgcacggctatgtgaaggct
cagctgcagcaggcacagcagggcgccgtagtgcccggcgctggcagcagcggcattcct
ggcgtgaaattgccagatttcagccagtttggtgaagttgaacgggaaggcatgtcgcgc
atgatgtctgttacggcgctgaacatgcaccgcagctggctgaatgtgccgcacgtcact
cagttcgaagacgccgacatcagcgatatggaagatttccgtaaatcgttgaagccattg
ggtgagaagaaaggcgtgaaaatgacgccgctgccgttcatgctcaaggcctgtgccgcg
gccctggctgaattgccccagttcaacgtcgccctggatatggatcgcaaagaagttgta
cacaagaagtacatccacatcggtattgcagtggatacgccccacggtttgatggttccg
gtgattcgtaatgtggaccagaaaggcctgtgggagttggcggctgaaagcgcagagctg
gctcagaaagcccgcgataagaagctgaagccggcagaaatgcagggcgcctgttttacc
attaccagccttggcggtattggaggcacggcctttacgccaatcgtgaatacgccggag
gtggcaatactgggtgtgtccaaagcggcgatgaagccagtttgggacggtaaagtcttc
cagccgcggctgatgctgccgttgtcactgtcttacgatcaccgtgcggtgaacggggca
gacgccgcgcgctttacttcggcgctggctcggctaatgggtgatattcgtaccctgttg
ctgtaa

DBGET integrated database retrieval system