KEGG   Marinobacter sp. BSs20148: MRBBS_3341Help
Entry
MRBBS_3341        CDS       T02323                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MRBBS_3341 (tpiA)
   01230 Biosynthesis of amino acids
    MRBBS_3341 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MRBBS_3341 (tpiA)
   00051 Fructose and mannose metabolism
    MRBBS_3341 (tpiA)
   00562 Inositol phosphate metabolism
    MRBBS_3341 (tpiA)
Enzymes [BR:mbs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MRBBS_3341 (tpiA)
Exosome [BR:mbs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MRBBS_3341 (tpiA)
  Exosomal proteins of bladder cancer cells
   MRBBS_3341 (tpiA)
  Exosomal proteins of melanoma cells
   MRBBS_3341 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3501760..3502518)
Genome map
AA seq 252 aa AA seqDB search
MRRRIVAGNWKMNGSQSLVNELVGPVAQQVRALGIEAVVFPPALYVSAVIQAADNAMAVG
VQNVSEKAQGAYTGELSALMAADVGCRYGLVGHSERRQLFGEADAQVAVKTEQLLCAGLS
AIVCVGETLAQREAGQAEAVVAAQVRDGLSKVAPEQWGQIVVAYEPVWAIGTGKTATGKD
AQAMHKAIRGVLADMGAPAESISLLYGGSVKADNAAALFAEPDIDGGLIGGASLNATDFV
SICQALPADTHC
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtcgcattgtagccggaaattggaaaatgaacggatctcaaagcctggtcaac
gagttggttggcccggttgcgcagcaggtgcgcgcattgggtattgaagcggtcgttttc
ccgcccgcgctctatgtttccgcggtgattcaggctgccgataacgcgatggcagtgggc
gtgcaaaatgtcagtgaaaaagcgcagggcgcctacaccggcgagctttctgcgcttatg
gcggccgatgttggttgccgttatggtctggtaggccactccgagcgacgtcagctgttt
ggcgaagccgatgcccaagtggcggtgaaaaccgagcagcttctctgcgcaggcttgagc
gccatcgtgtgcgtgggggaaactctggcgcagcgcgaagccgggcaggccgaagcagtt
gttgctgcccaagtgcgtgacggtttgagcaaagtagcgccagagcaatggggacagatt
gtcgttgcttatgagccggtttgggccataggcactggcaagacggccaccggcaaagac
gcccaagccatgcataaggccattcgtggcgtactggcagatatgggtgctccggccgaa
tccatttctctgctttacggcggcagcgtaaaagcggataatgcagccgcacttttcgct
gagccggatatagacggcggattgattggcggtgcgtctttgaatgcaacagattttgtc
agtatctgccaggcactgccggcagatacccattgttaa

DBGET integrated database retrieval system