KEGG   Marinobacter sp. BSs20148: MRBBS_3393Help
Entry
MRBBS_3393        CDS       T02323                                 

Gene name
gstB
Definition
glutathione S-transferase GST-6.0
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mbs00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3555871..3556479
Genome map
AA seq 202 aa AA seqDB search
MYTLYYLPGACSLATHAVLHELDQPVEIVDVQQLSNFTDINPVGTVPVLIDGDSTLREGA
AILLHLLNKHKNHMLPTSGASREQAIEDILFANATMHPAYSRLFFIAQHITDIHARETAF
TAAAEAINSLWQVVEQQLAGRDYLGGERVSAADFMLAVYSRWSAHFPVTITQGSNTSRML
DAVQAMPSFQRSLAAEQTRSAA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtacacactttactacctacccggcgcctgttcgctagcaacacatgcggtcttgcat
gaactggatcagcccgttgaaattgtcgacgtacagcaactgagtaattttactgacatc
aaccccgtcggtaccgtcccagtactaattgatggcgacagtacgttacgagaaggcgcc
gccattttgctgcacctgcttaataaacataaaaaccacatgctgcccactagtggtgcc
agccgtgaacaggctatcgaagatattttatttgccaatgccacaatgcatcccgcctat
agccgcttgttttttatcgcccagcacatcaccgatatacacgccagagaaaccgcgttt
actgccgctgccgaggccattaattcgctgtggcaggttgttgagcaacaactggcagga
cgggattatcttggcggtgagcgggtttctgctgccgatttcatgctcgcagtatattcc
cgctggagtgcacatttccctgtcacgattacgcaaggtagcaacacatcacgaatgtta
gatgcggtgcaggcaatgcccagctttcagcgttcgcttgccgccgaacaaacccggtca
gccgcttaa

DBGET integrated database retrieval system