KEGG   Marinobacter sp. BSs20148: MRBBS_3504Help
Entry
MRBBS_3504        CDS       T02323                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MRBBS_3504
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MRBBS_3504
Enzymes [BR:mbs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MRBBS_3504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3664308..3665900)
Genome map
AA seq 530 aa AA seqDB search
MPYSKDVDTLTTLLKQNPTWNAIKPEHAARMRAQNKFQTGLDIAKYTAKIMREDMANYDN
DTSQYTQSLGCWHGFIGQQKMISIKKHFGDTSRRYLYLSGWMVAALRSEFGPLPDQSMHE
KTAVSSLIGELYTFLRQADSWELNHLFRDLEEAQNAGDDAKAEQLISQIDNHQTHIVPII
ADIDAGFGNAEATYLLAKQMIEAGACCIQIENQVSDEKQCGHQDGKVTVPHADFLAKINA
VRLAFLELGVDDGVIVARTDSLGAGLTQKIAVTDEPGDLGDQYNSFIDGDVIAKAEDINN
GDVVIKQNGQLVKPKRLASGLFQFKAGSGEDRVILDCITSLQNGADMLWIETEKPHVGQI
AAMVNRIKEVVPNAKLVYNNSPSFNWTLSFRQQVFDSWKKEGKDVLAYERAALMGEEYDS
TDLGKLADQWTADFQRDAAREAGVFHHLITLPTYHTAALSTDNLAKGYFGAEGMLAYVKG
VQRKEIRQGIATVKHQDMAGSNIGDDHKEFFAGDAALKAGGKDNTMNQFG
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgccctactcaaaagacgttgataccctaaccaccctgttgaaacagaatcctacctgg
aacgccatcaagcctgagcacgcggcccgcatgcgcgcccagaacaaatttcagaccggt
ctggatatcgccaagtacaccgccaagattatgcgtgaagacatggcgaactacgataac
gatacctctcagtacacccagtctctggggtgctggcacggttttatcggccagcagaag
atgatttccattaagaaacacttcggcgacacctcacgccgctacctgtacctgtccggt
tggatggttgccgccctgcgttcagagttcggcccgctgccagaccagtccatgcacgag
aaaaccgccgtatccagcctgattggcgagttatacacgtttctgcggcaagctgattcc
tgggaactgaaccatctgttccgtgatctggaagaagctcagaacgccggcgacgacgcc
aaggccgagcagctgataagccagattgataaccatcagacccacattgtgccgatcatt
gccgacatcgacgccggttttggtaacgcagaagccacttacctgctggccaagcagatg
attgaagccggtgcctgctgtatccagattgaaaaccaggtgtctgacgagaagcagtgc
ggccaccaggacggcaaagtaaccgttccccacgccgactttctggccaagatcaacgct
gtgcgtttggccttcctggaactgggtgtagacgacggcgtgattgttgcccgtactgac
tccttgggtgctggcctgactcagaaaattgccgtaaccgacgagccgggtgacctgggc
gaccagtacaacagcttcatcgacggtgacgttattgctaaagccgaagacatcaacaac
ggcgacgtggtgatcaagcagaacggtcagctggtcaagcccaagcgtctggcgtctgga
ttgttccagttcaaggccggtagcggtgaagaccgggttattctggattgcatcaccagc
ctgcagaacggcgctgacatgctgtggatcgaaaccgagaagccccacgttggccagatc
gcagcgatggttaaccgcatcaaggaagtagttcctaacgccaagctggtgtacaacaac
agcccgtcgttcaactggactctgagcttccgtcaacaggtgttcgattcctggaaaaaa
gaaggcaaagacgtattggcctacgagcgtgctgcgctgatgggtgaagaatacgacagc
accgacctgggcaagctggccgatcagtggacggcggacttccagcgcgatgccgctcgc
gaagccggtgtgtttcaccacctgatcacgctgccgacttaccacacggcggccctgtcg
accgataacctggccaaaggctatttcggtgccgaaggcatgctggcttatgtcaaaggt
gttcagcgtaaagaaattcgccagggtatcgccactgttaagcaccaggacatggccggt
tccaacattggtgacgaccacaaggaatttttcgccggcgacgccgcgctgaaagccggt
ggtaaagacaacactatgaaccagtttggctaa

DBGET integrated database retrieval system