KEGG   Marinobacter sp. BSs20148: MRBBS_3504Help
Entry
MRBBS_3504        CDS       T02323                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
mbs00630  Glyoxylate and dicarboxylate metabolism
mbs01100  Metabolic pathways
mbs01110  Biosynthesis of secondary metabolites
mbs01120  Microbial metabolism in diverse environments
mbs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MRBBS_3504
Enzymes [BR:mbs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MRBBS_3504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase DUF4976
Motif
Other DBs
NCBI-ProteinID: AFP32440
UniProt: M1FGL1
Position
complement(3664308..3665900)
Genome map
AA seq 530 aa AA seqDB search
MPYSKDVDTLTTLLKQNPTWNAIKPEHAARMRAQNKFQTGLDIAKYTAKIMREDMANYDN
DTSQYTQSLGCWHGFIGQQKMISIKKHFGDTSRRYLYLSGWMVAALRSEFGPLPDQSMHE
KTAVSSLIGELYTFLRQADSWELNHLFRDLEEAQNAGDDAKAEQLISQIDNHQTHIVPII
ADIDAGFGNAEATYLLAKQMIEAGACCIQIENQVSDEKQCGHQDGKVTVPHADFLAKINA
VRLAFLELGVDDGVIVARTDSLGAGLTQKIAVTDEPGDLGDQYNSFIDGDVIAKAEDINN
GDVVIKQNGQLVKPKRLASGLFQFKAGSGEDRVILDCITSLQNGADMLWIETEKPHVGQI
AAMVNRIKEVVPNAKLVYNNSPSFNWTLSFRQQVFDSWKKEGKDVLAYERAALMGEEYDS
TDLGKLADQWTADFQRDAAREAGVFHHLITLPTYHTAALSTDNLAKGYFGAEGMLAYVKG
VQRKEIRQGIATVKHQDMAGSNIGDDHKEFFAGDAALKAGGKDNTMNQFG
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgccctactcaaaagacgttgataccctaaccaccctgttgaaacagaatcctacctgg
aacgccatcaagcctgagcacgcggcccgcatgcgcgcccagaacaaatttcagaccggt
ctggatatcgccaagtacaccgccaagattatgcgtgaagacatggcgaactacgataac
gatacctctcagtacacccagtctctggggtgctggcacggttttatcggccagcagaag
atgatttccattaagaaacacttcggcgacacctcacgccgctacctgtacctgtccggt
tggatggttgccgccctgcgttcagagttcggcccgctgccagaccagtccatgcacgag
aaaaccgccgtatccagcctgattggcgagttatacacgtttctgcggcaagctgattcc
tgggaactgaaccatctgttccgtgatctggaagaagctcagaacgccggcgacgacgcc
aaggccgagcagctgataagccagattgataaccatcagacccacattgtgccgatcatt
gccgacatcgacgccggttttggtaacgcagaagccacttacctgctggccaagcagatg
attgaagccggtgcctgctgtatccagattgaaaaccaggtgtctgacgagaagcagtgc
ggccaccaggacggcaaagtaaccgttccccacgccgactttctggccaagatcaacgct
gtgcgtttggccttcctggaactgggtgtagacgacggcgtgattgttgcccgtactgac
tccttgggtgctggcctgactcagaaaattgccgtaaccgacgagccgggtgacctgggc
gaccagtacaacagcttcatcgacggtgacgttattgctaaagccgaagacatcaacaac
ggcgacgtggtgatcaagcagaacggtcagctggtcaagcccaagcgtctggcgtctgga
ttgttccagttcaaggccggtagcggtgaagaccgggttattctggattgcatcaccagc
ctgcagaacggcgctgacatgctgtggatcgaaaccgagaagccccacgttggccagatc
gcagcgatggttaaccgcatcaaggaagtagttcctaacgccaagctggtgtacaacaac
agcccgtcgttcaactggactctgagcttccgtcaacaggtgttcgattcctggaaaaaa
gaaggcaaagacgtattggcctacgagcgtgctgcgctgatgggtgaagaatacgacagc
accgacctgggcaagctggccgatcagtggacggcggacttccagcgcgatgccgctcgc
gaagccggtgtgtttcaccacctgatcacgctgccgacttaccacacggcggccctgtcg
accgataacctggccaaaggctatttcggtgccgaaggcatgctggcttatgtcaaaggt
gttcagcgtaaagaaattcgccagggtatcgccactgttaagcaccaggacatggccggt
tccaacattggtgacgaccacaaggaatttttcgccggcgacgccgcgctgaaagccggt
ggtaaagacaacactatgaaccagtttggctaa

DBGET integrated database retrieval system