KEGG   Marinobacter sp. BSs20148: MRBBS_3540Help
Entry
MRBBS_3540        CDS       T02323                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
mbs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mbs01100  Metabolic pathways
mbs01110  Biosynthesis of secondary metabolites
mbs01130  Biosynthesis of antibiotics
mbs01230  Biosynthesis of amino acids
Module
mbs_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MRBBS_3540 (trpC)
Enzymes [BR:mbs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MRBBS_3540 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AFP32476
UniProt: M1FAR8
Position
3703055..3703879
Genome map
AA seq 274 aa AA seqDB search
MEAKKMNTQNDKTPTILRKIVDRKWQEIEQRQRTASLADLKARAGDQPGTRGFAKALRQR
IEASKPAVIAEIKKASPSKGILRDPFEPAQVAESYEKGGATCLSVLTDHDFFQGHEDFMV
AARNACSLPVIRKDFMVSPYQVYESRSIGADCILLIAACLTRGQMQELEGIAYETGLDVL
VEVHNSEELDDALTLSTPLVGINNRDLHSFEVSLETTFNLHQLIGPERLVITESGIMTRA
DVETMTGRGIYGFLIGESFMRAPDPGAKLQELFA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaaaaaatgaacacacagaacgacaaaacccccaccatcctgcgcaaaatc
gtcgacaggaaatggcaggaaattgaacagcgccagcgcaccgccagcctggctgaccta
aaagcacgcgccggcgaccaacccggcacccgcggctttgccaaagctctgcgccagcgc
atagaagcctcaaaacctgcggttattgccgaaattaaaaaagcgtcgcccagcaaaggc
atactgcgcgaccccttcgagccggcgcaggtcgccgaaagctatgaaaaaggcggcgct
acttgcctatccgtactcaccgaccacgacttcttccagggccacgaagacttcatggtg
gccgcccgcaacgcctgcagcctgcccgttatccgtaaagattttatggtatcgccctat
caggtgtatgaatcccgcagcattggtgccgattgcatactgcttattgcggcctgcctg
accagaggccagatgcaggagctcgaaggcattgcctacgaaacaggcctcgacgtgctg
gtagaagttcacaacagcgaagaattggacgacgccctcaccctcagcaccccgcttgta
ggcatcaacaaccgcgatctgcacagctttgaggtatcactggaaaccacctttaacctg
caccagctgattggccccgagcgactcgtcatcaccgaaagcgggattatgacccgcgcc
gacgtcgaaaccatgaccggccgcggcatttatggttttctaatcggtgagtcattcatg
cgcgcccctgacccgggagccaagctgcaggaactgtttgcataa

DBGET integrated database retrieval system