KEGG   Marinobacter sp. BSs20148: MRBBS_3693Help
Entry
MRBBS_3693        CDS       T02323                                 

Gene name
folE
Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MRBBS_3693 (folE)
Enzymes [BR:mbs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     MRBBS_3693 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3856010..3856582
Genome map
AA seq 190 aa AA seqDB search
MSNSLTDDLAGHYRAIINGLGENCDREGLQNTPLRAAKAMQFLTRGYQQDLNELVNNAVF
ESAMDEMVVIQDIELYSMCEHHVLPFIGKCHIAYLPQGKVLGLSKFARIVDMYARRLQIQ
ENLTRQIAEAVESVTNAKGVAVVIEAQHMCMMMRGVEKQNSKMKTSMMLGQFRKSQATRL
EFFNLISTNR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattccctgacagacgatcttgctggccactaccgcgccattattaatggcttg
ggtgaaaactgtgaccgcgaaggcctgcaaaacacgcctctgcgcgcggccaaagccatg
cagtttctaactcgcgggtaccagcaggatctgaacgagttggtcaacaacgcggtgttc
gaatccgccatggacgaaatggtggtgatacaggacatagaactgtacagcatgtgtgaa
catcacgtgttgccttttatcggcaagtgccacattgcctacctgccccagggcaaggtc
ctggggctgtccaaattcgcgcgcattgtcgatatgtacgcaaggcgcctacaaattcag
gaaaacctgacccgacagattgcggaagcggtagaaagtgtgaccaacgccaagggcgtg
gccgtcgtgatcgaagcccagcacatgtgcatgatgatgcgtggcgtcgaaaaacagaac
tcgaaaatgaagacctcgatgatgctcggccagttccgaaagtcacaggccacccgcctg
gaattcttcaatctgatcagtaccaaccgttga

DBGET integrated database retrieval system