KEGG   Mycobacterium bovis BCG Tokyo 172: JTY_0063Help
Entry
JTY_0063          CDS       T00864                                 

Gene name
celA1
Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mbt  Mycobacterium bovis BCG Tokyo 172
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    JTY_0063 (celA1)
Enzymes [BR:mbt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     JTY_0063 (celA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
65544..66686
Genome map
AA seq 380 aa AA seqDB search
MTRRTGQRWRGTLPGRRPWTRPAPATCRRHLAFVELRHYFARVMSSAIGSVARWIVPLLG
VAAVASIGVIAAPVRVVRAPALILVDAANPLAGKPFYVDPASAAMVAARNANPPNAELTS
VANTPQSYWLDQAFPPATVGGTVARYTGAAQAAGAMPVLTLYGIPHRDCGSYASGGFATG
TDYRGWIDAVASGLGSSPATIIVEPDALAMADCLSPDQRQERFDLVRYAVDTLTRDPAAA
VYVDAGHSRWLSAEAMAARLNDVGVGRARGFSLNVSNFYTTDEEIGYGEAISGLTNGSHY
VIDTSRNGAGPAPDAPLNWCNPSGRALGAPPTTATAGAHADAYLWIKRPGESDGTCGRGE
PQAGRFVSQYAIDLAHNAGQ
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtcggactgggcagcgatggcgcgggactctgcccgggcgccggccttggaca
cggccagcgcccgccacctgtcgtcggcatttggcgtttgtcgaattgcggcattatttt
gctcgggtgatgtcatcagctattggttcggtcgcgcggtggatagtccccctcctgggg
gttgcagccgttgcttccatcggtgttatcgcggccccggtgcgggtcgttcgggccccg
gcgttgatcctggtcgatgcggcaaacccgctggccggaaagcccttctacgtcgatccc
gcctcggcggccatggtcgccgcgcgcaacgccaacccgccgaacgccgagctgacctcc
gtcgccaacaccccgcagtcctactggctcgaccaggcattcccgccggcgaccgtcggc
ggcacggttgccaggtacaccggagcggcgcaggcggccggcgccatgccggttctgacg
ctgtatggaatcccccatcgcgactgcggtagctacgcatccggtgggttcgcgacgggc
actgattaccgcgggtggatcgacgctgtcgcatccggcctgggctcatcgccggcgacg
atcatcgtcgaacccgatgcgctggccatggccgactgcctgtcgcctgaccagcgccag
gaacgtttcgacttggtgcgctacgccgtcgacacgctgacccgcgacccggccgctgcc
gtgtacgtcgatgcggggcattcgcgctggctgagcgccgaggcaatggccgccaggctc
aacgatgtcggtgtgggccgcgcgcgcgggtttagcctcaacgtctcgaacttctacacc
accgatgaggaaatcggctatggcgaggcgatttcggggctcacgaacggttcgcattac
gtgatcgacacgtcgcgcaacggcgccggacccgcgcccgacgccccgctcaactggtgt
aaccccagcggccgcgccctgggcgcaccgcccaccacggcgaccgcgggcgcgcacgcc
gacgcttacctgtggatcaaacgtcccggggaatcggacggaacctgcggtcgcggggag
cctcaggcgggtcggttcgttagccagtacgccatcgatctggcccacaacgccggccag
tag

DBGET integrated database retrieval system