KEGG   Mycobacterium bovis BCG Tokyo 172: JTY_0145Help
Entry
JTY_0145          CDS       T00864                                 

Definition
oxidoreductase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
mbt  Mycobacterium bovis BCG Tokyo 172
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
166057..167079
Genome map
AA seq 340 aa AA seqDB search
MNAPKLVIGANGFLGSHVTRQLVADCAPQKGEVRAMVRPAANTRSIDDLPLTRFHGDVFD
TATVAEAMAGCDDVYYCVVDTRAWLRDPSPLFRTNVAGLRNVLDVATDASLRRFVFTSSY
ATVGRRRGHVATEEDRVDTRKVTPYVRSRVAAEDLVLQYAHDAGLPAVAMCVSTTYGGGD
WGRTPHGAFIAGAVFGRLPFTMRGIRLEAVGVDDAARALILAAERGRNGERYLISERMMP
LQEVVRIAADEAGVPPPRWSISVPVLYALGALGSLRARLTGKDTELSLASVRMMRSEADV
DHGKAVRELGWQPRPVEESIREAARFWAAMRTVGKDPAAS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacccaagctggtcattggcgcgaacggcttcctgggttcgcacgtgactcgc
cagctcgtcgccgactgcgcgccgcagaaaggtgaggtacgcgcgatggtgcgacccgct
gccaacacccggagcatcgacgatctaccgctcacccgattccacggcgacgtcttcgac
accgccaccgtggccgaggcgatggccggctgcgacgacgtctactactgtgtggtcgac
acccgcgcctggttgcgcgatccctccccgctgtttcgcaccaatgtggcaggcctgcgc
aacgtcctcgatgtggccacagacgccagcctgcgcaggttcgtcttcaccagcagttat
gcgacggtgggtcgtcggcgtggacacgtggcgaccgaagaagaccgggtggatacccgc
aaggtgactccttacgtgcggtcccgggtggcggccgaggatctggtgctgcaatacgcg
cacgacgcaggtctgcccgccgtcgcgatgtgtgtgtcgacaacctacggcggcggcgac
tggggccgcaccccacacggcgccttcatcgcgggcgcggtgttcggcaggctgcctttc
acgatgcgcggcatccggctggaggcggtgggtgtcgacgatgctgcgagggcgctgatc
ttggcggccgaacgcgggcgcaacggcgaacggtacctcatctccgaacgcatgatgccg
ttgcaagaagtggtgcggatcgccgcggatgaggccggtgtcccgccgccacgatggtcg
atctcggtgccggtgctttacgccctgggtgcgttgggcagtttgcgagcccgactcacg
ggcaaagataccgaactcagcctggcgtcggtgcgcatgatgcgttccgaggccgatgtc
gaccacggcaaggccgtccgcgagttgggttggcagccacgtccggtggaggagtcgatc
cgggaggccgcccggttctgggcggcgatgcgcaccgtcgggaaggaccccgcggcctcg
tga

DBGET integrated database retrieval system